Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   103115
Name   oriT_pSCS23 in_silico
Organism   Salmonella enterica strain SC23
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_KU934209 (18031..18083 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pSCS23
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   2063 GenBank   WP_015059539
Name   t4cp2_HTH98_RS00260_pSCS23 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73404.02 Da        Isoelectric Point: 9.4339

>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 37781..60687

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTH98_RS00195 32839..33492 - 654 WP_170855322 hypothetical protein -
HTH98_RS00200 33504..34628 - 1125 WP_000486716 site-specific integrase -
HTH98_RS00420 34961..35179 + 219 Protein_42 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTH98_RS00210 35843..37129 - 1287 WP_015057162 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTH98_RS00215 37142..37777 - 636 WP_000934977 A24 family peptidase -
HTH98_RS00220 37781..38263 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
HTH98_RS00225 38329..38892 - 564 WP_034169414 type 4 pilus major pilin -
HTH98_RS00230 38942..40051 - 1110 WP_000974903 type II secretion system F family protein -
HTH98_RS00235 40042..41580 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
HTH98_RS00240 41605..42099 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
HTH98_RS00245 42083..43405 - 1323 WP_000454142 type 4b pilus protein PilO2 -
HTH98_RS00250 43444..45087 - 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
HTH98_RS00255 45080..45616 - 537 WP_001220543 sigma 54-interacting transcriptional regulator virb4
HTH98_RS00260 45663..47621 - 1959 WP_015059539 type IV secretory system conjugative DNA transfer family protein -
HTH98_RS00265 47637..48692 - 1056 WP_001542006 P-type DNA transfer ATPase VirB11 virB11
HTH98_RS00270 48711..49850 - 1140 WP_034169415 TrbI/VirB10 family protein virB10
HTH98_RS00275 49840..50541 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
HTH98_RS00280 50607..51341 - 735 WP_000432282 type IV secretion system protein virB8
HTH98_RS00285 51507..53864 - 2358 WP_000548950 VirB4 family type IV secretion system protein virb4
HTH98_RS00290 53870..54190 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
HTH98_RS00415 54261..54551 - 291 WP_000865479 conjugal transfer protein -
HTH98_RS00300 54551..55135 - 585 WP_001177117 lytic transglycosylase domain-containing protein virB1
HTH98_RS00305 55156..55554 - 399 WP_001153669 hypothetical protein -
HTH98_RS00310 55673..56110 - 438 WP_034169416 type IV pilus biogenesis protein PilM -
HTH98_RS00315 56116..57351 - 1236 WP_034169417 toxin co-regulated pilus biosynthesis Q family protein -
HTH98_RS00320 57354..57653 - 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
HTH98_RS00325 57701..58510 + 810 WP_024237698 DUF5710 domain-containing protein -
HTH98_RS00330 58733..58957 - 225 WP_000713562 EexN family lipoprotein -
HTH98_RS00335 59045..59686 - 642 WP_001425343 type IV secretion system protein -
HTH98_RS00340 59692..60687 - 996 WP_001028540 type IV secretion system protein virB6
HTH98_RS00345 60691..60948 - 258 WP_000739144 hypothetical protein -
HTH98_RS00350 60945..61298 - 354 WP_223286767 hypothetical protein -
HTH98_RS00355 61518..61964 - 447 WP_001243165 hypothetical protein -
HTH98_RS00360 61975..62145 - 171 WP_000550720 hypothetical protein -
HTH98_RS00365 62149..62592 - 444 WP_000964330 NfeD family protein -
HTH98_RS00370 62966..63919 - 954 WP_072089442 SPFH domain-containing protein -
HTH98_RS00375 63946..64122 - 177 WP_000753050 hypothetical protein -
HTH98_RS00380 64115..64330 - 216 WP_001127357 DUF1187 family protein -
HTH98_RS00385 64323..64829 - 507 WP_001326595 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   3558 GenBank   NZ_KU934209
Plasmid name   pSCS23 Incompatibility group   IncI2
Plasmid size   65419 bp Coordinate of oriT [Strand]   18031..18083 [-]
Host baterium   Salmonella enterica strain SC23

Cargo genes


Drug resistance gene   blaCTX-M-55, mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -