Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   103096
Name   oriT_pOXAAPSS1 in_silico
Organism   Klebsiella pneumoniae
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_KU159085 (29838..29943 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      30..35, 41..46  (CCGCCG..CGGCGG)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 106 nt

>oriT_pOXAAPSS1
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   2318 GenBank   WP_004187323
Name   Relaxase_HTG51_RS00270_pOXAAPSS1 insolico UniProt ID   A0A3U8KUL3
Length   659 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75179.89 Da        Isoelectric Point: 9.9948

>WP_004187323.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

(86-334)


  Protein structure


Source ID Structure
AlphaFold DB A0A3U8KUL3


T4CP


ID   2044 GenBank   WP_228719393
Name   t4cp2_HTG51_RS00400_pOXAAPSS1 insolico UniProt ID   _
Length   560 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 560 a.a.        Molecular weight: 64000.30 Da        Isoelectric Point: 6.4338

>WP_228719393.1 conjugal transfer protein TrbC [Klebsiella pneumoniae]
MQQESVDSKKVLRPDGSFMEWFLTPNVQFGLLAILTVLGLFLPFTMLLSILILPPLMVAFTDRKFRPPLR
MPKDCEMFDDTLTTETQAEYRLGPIRIPHKVRERKKAKGILYVGYERGRLFGRELWLNMTDLLRHMVFFG
TTGSGKTETFYGFIVNFLLWCRGYCLSDGKADNKLAFATWSLARRFGREDDYYVLNLLTGSIDRFVNLVK
QESIPAQSNSVNLFSVAPPTFIIQLMESMLPQVGGDSAQWQDTAKAMMSALINALCYKRARGELLLSQRT
IQKNMSLPAMAALYVEAKKNGWHSEGYAALESYLENTPGFLLANAEYPETWEARAFEQHNYMSRQFLKTL
SLFNETYGHVFPEDSGDIRMDDIFHNDRILIVMIPSLELSRGEAATLGRLYVTLQRMTISKDLGYQLEGK
KEEVLLTHALNNQAPYGLIYDELGQYFTSGMDTLSAQMRSLEKMGVFSSQDHPSLARGANGEVDSLIANT
RVKYFESIEDRKTFEILRETVGQDYYSELSGQEAEHGTFSKTVREGDLYQIREKDRVNIRELRKQTEGRG

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 32739..60632

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTG51_RS00250 27823..28134 + 312 WP_004187333 hypothetical protein -
HTG51_RS00255 28267..28803 + 537 WP_004187332 hypothetical protein -
HTG51_RS00260 29305..29700 - 396 WP_019725163 hypothetical protein -
HTG51_RS00450 29699..30262 + 564 WP_020277892 plasmid mobilization protein MobA -
HTG51_RS00270 30249..32228 + 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
HTG51_RS00275 32242..32742 + 501 WP_004187320 DotD/TraH family lipoprotein -
HTG51_RS00280 32739..33518 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
HTG51_RS00285 33529..34692 + 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
HTG51_RS00290 34682..34942 + 261 WP_004187310 IcmT/TraK family protein traK
HTG51_RS00295 34967..36505 + 1539 WP_181372791 toprim domain-containing protein -
HTG51_RS00300 36505..38178 + 1674 WP_227601284 LPD7 domain-containing protein -
HTG51_RS00305 38144..38656 + 513 WP_011091071 hypothetical protein traL
HTG51_RS00310 38657..38854 - 198 WP_004187464 Hha/YmoA family nucleoid-associated regulatory protein -
HTG51_RS00315 38841..39251 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
HTG51_RS00320 39250..40032 + 783 WP_015058941 DotI/IcmL family type IV secretion protein traM
HTG51_RS00455 40041..40181 + 141 WP_228719390 hypothetical protein -
HTG51_RS00325 40221..41192 + 972 WP_228719391 DotH/IcmK family type IV secretion protein traN
HTG51_RS00330 41204..42553 + 1350 WP_004187474 conjugal transfer protein TraO traO
HTG51_RS00335 42565..43269 + 705 WP_015060002 conjugal transfer protein TraP traP
HTG51_RS00340 43293..43823 + 531 WP_004187478 conjugal transfer protein TraQ traQ
HTG51_RS00345 43840..44229 + 390 WP_004187479 DUF6750 family protein traR
HTG51_RS00350 44275..44769 + 495 WP_004187480 hypothetical protein -
HTG51_RS00355 44766..47816 + 3051 WP_004187482 hypothetical protein traU
HTG51_RS00360 47813..49021 + 1209 WP_011091082 conjugal transfer protein TraW traW
HTG51_RS00365 49018..49614 + 597 WP_015060003 hypothetical protein -
HTG51_RS00370 49607..50587 + 981 WP_228719392 DotA/TraY family protein traY
HTG51_RS00375 50621..51318 + 698 WP_095033700 IS1-like element IS1B family transposase -
HTG51_RS00380 51365..52579 + 1215 WP_077273780 DotA/TraY family protein traY
HTG51_RS00385 52581..53234 + 654 WP_015060005 hypothetical protein -
HTG51_RS00390 53303..53545 + 243 WP_023893611 IncL/M type plasmid replication protein RepC -
HTG51_RS00395 53829..54896 + 1068 WP_019725043 plasmid replication initiator RepA -
HTG51_RS00465 56119..56214 + 96 WP_004206884 DinQ-like type I toxin DqlB -
HTG51_RS00460 56265..56591 - 327 WP_064424685 hypothetical protein -
HTG51_RS00400 56669..58351 - 1683 WP_228719393 conjugal transfer protein TrbC -
HTG51_RS00405 58364..59314 - 951 WP_004206886 DsbC family protein trbB
HTG51_RS00410 59325..60632 - 1308 WP_015059988 hypothetical protein trbA
HTG51_RS00415 60632..60988 - 357 WP_015586032 lytic transglycosylase domain-containing protein -
HTG51_RS00420 61132..61527 - 396 WP_015059989 DUF1496 domain-containing protein -
HTG51_RS00425 61595..62029 + 435 Protein_87 CPBP family intramembrane glutamate endopeptidase -
HTG51_RS00430 62044..63252 - 1209 WP_001206290 IS4-like element IS10A family transposase -


Host bacterium


ID   3539 GenBank   NZ_KU159085
Plasmid name   pOXAAPSS1 Incompatibility group   IncL/M
Plasmid size   63359 bp Coordinate of oriT [Strand]   29838..29943 [+]
Host baterium   Klebsiella pneumoniae

Cargo genes


Drug resistance gene   blaOXA-48
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA8