Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103091
Name   oriT_pSE115 in_silico
Organism   Salmonella enterica subsp. enterica serovar Enteritidis strain SE115
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_KT868530 (29616..29704 [-], 89 nt)
oriT length   89 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 89 nt

>oriT_pSE115
GGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2314 GenBank   WP_012783930
Name   nikB_HT114_RS00225_pSE115 insolico UniProt ID   N0GUP8
Length   899 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104070.55 Da        Isoelectric Point: 7.3623

>WP_012783930.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSHMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLAERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWLPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALVDKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(62-314)


  Protein structure


Source ID Structure
AlphaFold DB N0GUP8


Auxiliary protein

ID   977 GenBank   WP_001283947
Name   WP_001283947_pSE115 insolico UniProt ID   A0A142CMC2
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12613.57 Da        Isoelectric Point: 10.7463

>WP_001283947.1 MULTISPECIES: IncI1-type relaxosome accessory protein NikA [Enterobacteriaceae]
MSDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALNKRINSRTDDAFLKELMRL
GRMQKHLFVQGKRTGDKEYAEVLVAITELTNTLRKQLMEG

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB A0A142CMC2


T4CP

ID   2038 GenBank   WP_012783931
Name   trbC_HT114_RS00230_pSE115 insolico UniProt ID   _
Length   763 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 763 a.a.        Molecular weight: 86911.02 Da        Isoelectric Point: 6.7713

>WP_012783931.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MSEHRVNPELLHRTAWGNPVWNALQSLNIYGFCLVASLVASFIWPLALPACLLFTLITMLVFSLQRWRCP
LRMPMTLECADPSQDRMIKRSLFSFWPTLFQYEVILESPASGIFYVGYQRVRDIGRELWLSMDDLTRHIM
FFATTGGGKTETIFAWAINPLCWARGFTLVDGKAQNDTARTIWYLARRFGREDDVEVINFMNGGKSRSEI
ILSGEKTRPQSNTWNPFCYSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDLSLVRTPSAWTEEPRKQHAYLSGQFSE
TFSTFTEAFGDIFAEDSGDIDIRDSIHSDRILMVMIPALDTSAHTTSALGRMFITQKSMILARDLGYRLE
GTDSDALEVKKYKGRFPYLCFLDEVGAYYTDRIAVEATQVRSLDFALILTAQDQERIEGQTTATNTATLM
QNTGTKFAGRIVSEGSTARTLKSAAGEEARARMNNLQRQDGIFGESWIDSPQISILMESKINVQELIELH
PGEFFSIFRGETVPSASFFIPDDEKSCSSDPVVINRYISVDAPRLDRLRRLVPRTTQRRIPSPENVSAII
GVLTAKPSRKRRKIRTEPHTIVDTFQQRIAGRQAAMAMLEEYDTDINARESALWETAVNTLKTTTREERR
IRYITLNRPELPETKEENQISVRAERAGINLLTLPQDNNHPTGRPVNGFHHKKTNRPDWDGMY

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 35082..77538

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HT114_RS00230 32798..35089 - 2292 WP_012783931 F-type conjugative transfer protein TrbC -
HT114_RS00235 35082..36152 - 1071 WP_012783932 IncI1-type conjugal transfer protein TrbB trbB
HT114_RS00240 36171..37379 - 1209 WP_001703845 IncI1-type conjugal transfer protein TrbA trbA
HT114_RS00245 37686..38465 - 780 WP_275450201 protein FinQ -
HT114_RS00250 39092..39244 + 153 WP_001387489 Hok/Gef family protein -
HT114_RS00255 39316..39567 - 252 WP_001291964 hypothetical protein -
HT114_RS00520 40068..40163 + 96 WP_000609148 DinQ-like type I toxin DqlB -
HT114_RS00265 40228..40512 - 285 WP_014640317 hypothetical protein -
HT114_RS00270 40796..41005 + 210 WP_000062603 HEAT repeat domain-containing protein -
HT114_RS00275 41077..41739 - 663 WP_012783935 plasmid IncI1-type surface exclusion protein ExcA -
HT114_RS00280 41810..43978 - 2169 WP_015508354 DotA/TraY family protein traY
HT114_RS00285 44075..44659 - 585 WP_001037998 conjugal transfer protein TraX -
HT114_RS00290 44688..45887 - 1200 Protein_55 IncI1-type conjugal transfer protein TraW -
HT114_RS00295 45854..46466 - 613 Protein_56 IncI1-type conjugal transfer protein TraV -
HT114_RS00300 46466..49509 - 3044 Protein_57 IncI1-type conjugal transfer protein TraU -
HT114_RS00305 49599..50398 - 800 Protein_58 IncI1-type conjugal transfer protein TraT -
HT114_RS00310 50382..50570 - 189 WP_001277255 putative conjugal transfer protein TraS -
HT114_RS00315 50634..51038 - 405 WP_000086965 IncI1-type conjugal transfer protein TraR traR
HT114_RS00320 51089..51616 - 528 WP_001055569 conjugal transfer protein TraQ traQ
HT114_RS00325 51616..52320 - 705 WP_064198837 IncI1-type conjugal transfer protein TraP traP
HT114_RS00330 52320..53609 - 1290 WP_001271994 conjugal transfer protein TraO traO
HT114_RS00335 53612..54595 - 984 WP_001191880 IncI1-type conjugal transfer protein TraN traN
HT114_RS00340 54606..55298 - 693 WP_000138551 DotI/IcmL family type IV secretion protein traM
HT114_RS00345 55295..55642 - 348 WP_001055900 conjugal transfer protein traL
HT114_RS00350 55660..59424 - 3765 WP_064198838 LPD7 domain-containing protein -
HT114_RS00355 59514..60065 - 552 WP_000014586 phospholipase D family protein -
HT114_RS00360 60080..60370 - 291 WP_001299214 hypothetical protein traK
HT114_RS00365 60367..61515 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
HT114_RS00370 61512..62330 - 819 WP_032220737 IncI1-type conjugal transfer lipoprotein TraI traI
HT114_RS00375 62327..62785 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
HT114_RS00380 63201..63860 - 660 Protein_73 IS5 family transposase -
HT114_RS00385 63895..64770 - 876 WP_001617865 extended-spectrum class A beta-lactamase CTX-M-14 -
HT114_RS00390 65020..66282 - 1263 WP_000608644 IS1380-like element ISEcp1 family transposase -
HT114_RS00395 66435..67040 - 606 WP_064198839 lipopolysaccharide core heptose(II)-phosphate phosphatase -
HT114_RS00400 67100..68302 - 1203 WP_000976353 conjugal transfer protein TraF -
HT114_RS00405 68388..69212 - 825 WP_001690630 conjugal transfer protein TraE traE
HT114_RS00410 69363..70517 - 1155 WP_001139955 site-specific integrase -
HT114_RS00510 70501..70869 + 369 WP_015059923 hypothetical protein -
HT114_RS00425 71909..73057 - 1149 WP_235671716 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HT114_RS00430 73045..73701 - 657 WP_001193549 A24 family peptidase -
HT114_RS00435 73686..74246 - 561 WP_000014005 lytic transglycosylase domain-containing protein virB1
HT114_RS00440 74256..74870 - 615 WP_000908227 type 4 pilus major pilin -
HT114_RS00445 74887..75972 - 1086 WP_001208802 type II secretion system F family protein -
HT114_RS00450 75985..77538 - 1554 WP_000362206 ATPase, T2SS/T4P/T4SS family virB11
HT114_RS00455 77549..78001 - 453 WP_064198840 type IV pilus biogenesis protein PilP -
HT114_RS00460 77988..79283 - 1296 WP_064198841 type 4b pilus protein PilO2 -
HT114_RS00465 79276..80958 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
HT114_RS00470 80972..81409 - 438 WP_000539806 type IV pilus biogenesis protein PilM -
HT114_RS00475 81409..82476 - 1068 WP_001360287 type IV pilus biogenesis lipoprotein PilL -

Host bacterium

ID   3534 GenBank   NZ_KT868530
Plasmid name   pSE115 Incompatibility group   IncI
Plasmid size   87255 bp Coordinate of oriT [Strand]   29616..29704 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Enteritidis strain SE115

Cargo genes

Drug resistance gene   blaCTX-M-14
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrVA2