Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103090
Name   oriT_pEC3I in_silico
Organism   Escherichia coli
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_KU932021 (53958..54030 [+], 73 nt)
oriT length   73 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 73 nt

>oriT_pEC3I
GTCGGGGCAAAGCCCTGACCAGGTGGGGAATGTCTGAGTGCGCGTGCGCGGTCCGACATTCCCACATCCTGTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2313 GenBank   WP_000991387
Name   Relaxase_HTJ34_RS00265_pEC3I insolico UniProt ID   A0A7I0L2J7
Length   903 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 903 a.a.        Molecular weight: 104567.95 Da        Isoelectric Point: 7.5259

>WP_000991387.1 MULTISPECIES: relaxase/mobilization nuclease domain-containing protein [Enterobacteriaceae]
MNAIIPHKRRDGRSSFEDLIAYTSVRDDVQENELTEDSEIKSDVPHRNRFRRLVDYATRLRNEKFVSLID
VMKDGSQWVNFYGVTCFHNCNSLETAAEEMQYKADKAVFSRNDTDPVFHYILSWPAHESPRPEQLFDCVR
HTLKSLELSKHQYVAAVHTDTDNLHVHVAVNRVHPETGYINWLSWSQEKLSRACRELELKHGFAPDNGCF
VHAPGNRIVRKTALVRERRNAWRRGKKQTFREYIAQMSIAGLREEPAQDWLSLHKRLASDGLYITMQEGE
LVVKDGWDRAREGVALSSFGPSWTAEKLGRKLGEYQPVPTDIFSQVGTPGRYDPEAINVDIRPEKVAETE
SLKQYACRYFAERLPEMARNGELESCLDVHRTLAKAGLWMGIQHGHLVLHDGFDKQQTPVRADSVWPLMT
LDYMQDLDGGWQPVPKDIFTQVIPGERFRGRNLGTQAVSDYEWYRMRMGTGPQGAIKRELFSDKESLWGY
TTVQCESLIEDMIAGGNFSWQACHEMFARKGLMLQKQHHGLVIVDAFNHELTPVKASSIHPDLTLSRAEL
QAGPFEIAGADIFERVKPECRYNPELAASDEVEPGFRRDPVLRRERREARAAAREDLRARYLAWKEHWRK
PDLRYGERLREIHAACRRRKAYIRVQFRDPQLRKLHYHIAEVQRMQALIRLKESVKEERLSLIAEGKWYP
LSYRQWVEQQAVQGDRAALSQLRGWDYRDRRKDKRRTTNADRCVILCEPGGTPLYEDTGVLEARLQKDGS
VRFRDRRNGELVCVDYGDRVVFYHHQDRNELVDKLNLIAPVLFDREPGMGFEPEGSYQQFNDVFAEMVAW
HNAAGITGNGHFVISRPDVDLHRQRSEQYYHEYIRQQKSISGGHGASYAPVQDNEWTPPSPGM

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(62-315)


  Protein structure


Source ID Structure
AlphaFold DB A0A7I0L2J7


Auxiliary protein

ID   976 GenBank   WP_001291058
Name   WP_001291058_pEC3I insolico UniProt ID   A0A7I0L241
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12730.52 Da        Isoelectric Point: 9.9656

>WP_001291058.1 MULTISPECIES: plasmid mobilization protein MobA [Enterobacteriaceae]
MSEKKTRTGSENRKRIVKFTARFTEDEAEIVREKAESSGQTVSTFIRSSSLDKVVNCRTDDRMIDEIMRL
GRLQKHLFVEGKRTGDKEYAEVLVAITEYVNALRRDLMGR

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB A0A7I0L241


T4CP

ID   2037 GenBank   WP_000077663
Name   trbC_HTJ34_RS00210_pEC3I insolico UniProt ID   _
Length   767 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 767 a.a.        Molecular weight: 87012.13 Da        Isoelectric Point: 7.3008

>WP_000077663.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MSQHHVNPDLIHRTAWGNPLWNALHNLNITGLCLAGSIITALIWPLALPVCLLFTLVTSVIFMLQRWRCP
LRMPMTLSLDDPSQDRKVRRSLFSFWPTLFQYEADETFPARGIFYVGYRRINDIGRELWLSMDDLTRHVM
FFATTGGGKTETTFAWLLNPLCWGRGFTFVDGKAQNDTTRTIWYLSRRFGREDDIEVINFMNGGKSRSEI
IQSGEKSRPQSNTWNPFAFSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDMSLVRTPSAWTEEPRKQHAYLSGQFSE
TFTTFAETFGDVFAADAGDIDIRDSIHSDRILIVMIPALDTSAHTTSALGRMFVTQQSMLLARDLGYRLE
GTDAQTLEVKKYKGSFPYICILDEVGAYYTDRIAVEATQVRSLEFSLIMTAQDQERIEGQTSATNTATLM
QNAGTKFAGRIVSDDKTARTVKNAAGEEARARMGSLQRHDGVMGESWVDGNQITIQMESKIDVQDLIRLN
AGEFFTVFQGDVVPSASVYIPDSEKSCDSDPVVINRYISVEAPRLERLRRLVPRTVQRRLPTPEHVSSII
GVLTAKPSRKRRKNRTEPYRIIDTFQRQLATAQTSLDLLPQYDTDIESRANELWKKAVHTINNTTREERR
VCYITLNRPEEEHSGPEDIPSVKAILNTLLPLEMLLPVPDLTASPPHKKNVAQTPSGGKQESRKKRF

  Protein domains


Predicted by InterproScan.

TraM recognition site of TraD and TraG (TraG-D_C)

(439-528)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 2897..38904

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTJ34_RS00010 1160..2254 + 1095 WP_000697158 type II secretion system F family protein -
HTJ34_RS00015 2316..2852 + 537 WP_000111534 type 4 pilus major pilin -
HTJ34_RS00020 2897..3382 + 486 WP_001080767 lytic transglycosylase domain-containing protein virB1
HTJ34_RS00025 3488..4024 + 537 WP_023649457 prepilin peptidase -
HTJ34_RS00030 4042..5403 + 1362 WP_001168171 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTJ34_RS00520 5517..5711 + 195 Protein_6 integrase -
HTJ34_RS00035 5876..6697 + 822 WP_000845373 hypothetical protein traE
HTJ34_RS00040 6799..8001 + 1203 WP_000979993 conjugal transfer protein TraF -
HTJ34_RS00045 8105..8563 + 459 WP_001170111 DotD/TraH family lipoprotein -
HTJ34_RS00050 8560..9396 + 837 WP_000745049 type IV secretory system conjugative DNA transfer family protein traI
HTJ34_RS00055 9380..10528 + 1149 WP_000775211 plasmid transfer ATPase TraJ virB11
HTJ34_RS00060 10525..10815 + 291 WP_000817801 IcmT/TraK family protein traK
HTJ34_RS00065 10879..14940 + 4062 WP_000842456 LPD7 domain-containing protein -
HTJ34_RS00070 14957..15307 + 351 WP_001056367 hypothetical protein traL
HTJ34_RS00075 15319..16014 + 696 WP_001287545 DotI/IcmL family type IV secretion protein traM
HTJ34_RS00080 16025..16999 + 975 WP_000547387 DotH/IcmK family type IV secretion protein traN
HTJ34_RS00085 17003..18340 + 1338 WP_001272020 conjugal transfer protein TraO traO
HTJ34_RS00090 18337..19050 + 714 WP_000787002 conjugal transfer protein TraP traP
HTJ34_RS00095 19047..19577 + 531 WP_000987021 conjugal transfer protein TraQ traQ
HTJ34_RS00100 19624..20022 + 399 WP_000088813 DUF6750 family protein traR
HTJ34_RS00535 20079..20330 + 252 WP_001277573 hypothetical protein -
HTJ34_RS00110 20437..21063 + 627 WP_000785708 hypothetical protein traT
HTJ34_RS00115 21056..21307 - 252 WP_001136184 hypothetical protein -
HTJ34_RS00120 21358..24402 + 3045 WP_001024766 conjugal transfer protein traU
HTJ34_RS00125 24402..25022 + 621 WP_000286854 hypothetical protein traV
HTJ34_RS00130 24980..26185 + 1206 WP_001189548 conjugal transfer protein TraW traW
HTJ34_RS00135 26182..26751 + 570 WP_000650752 conjugal transfer protein TraX -
HTJ34_RS00140 26826..28991 + 2166 WP_000691814 DotA/TraY family protein traY
HTJ34_RS00145 29079..29732 + 654 WP_001401768 plasmid IncI1-type surface exclusion protein ExcA -
HTJ34_RS00150 30006..31592 + 1587 WP_000004564 TnsA endonuclease N-terminal domain-containing protein -
HTJ34_RS00155 31730..31882 - 153 WP_001335079 Hok/Gef family protein -
HTJ34_RS00160 32212..32454 + 243 WP_000650923 hypothetical protein -
HTJ34_RS00165 32745..33113 + 369 WP_001345852 hypothetical protein -
HTJ34_RS00170 33117..33332 + 216 WP_000266543 hypothetical protein -
HTJ34_RS00175 33530..34153 - 624 WP_001155250 helix-turn-helix domain-containing protein -
HTJ34_RS00180 34313..34780 + 468 WP_000598962 thermonuclease family protein -
HTJ34_RS00185 34930..35106 + 177 WP_001054907 hypothetical protein -
HTJ34_RS00540 35169..35264 - 96 WP_001363141 DinQ-like type I toxin DqlB -
HTJ34_RS00545 35853..35948 - 96 WP_001363141 DinQ-like type I toxin DqlB -
HTJ34_RS00195 36001..36294 - 294 WP_023636565 hypothetical protein -
HTJ34_RS00200 36485..37783 + 1299 WP_000121917 IncI1-type conjugal transfer protein TrbA trbA
HTJ34_RS00205 37780..38904 + 1125 WP_000152378 DsbC family protein trbB
HTJ34_RS00210 38885..41188 + 2304 WP_000077663 F-type conjugative transfer protein TrbC -
HTJ34_RS00215 41302..41595 + 294 WP_000334996 hypothetical protein -
HTJ34_RS00220 42052..42867 + 816 WP_001043260 sulfonamide-resistant dihydropteroate synthase Sul2 -
HTJ34_RS00225 42928..43731 + 804 WP_001082319 aminoglycoside O-phosphotransferase APH(3'')-Ib -
HTJ34_RS00230 43731..43838 + 108 Protein_47 aminoglycoside phosphotransferase family protein -

Host bacterium

ID   3533 GenBank   NZ_KU932021
Plasmid name   pEC3I Incompatibility group   IncB/O/K/Z
Plasmid size   91885 bp Coordinate of oriT [Strand]   53958..54030 [+]
Host baterium   Escherichia coli

Cargo genes

Drug resistance gene   sul2, aph(3'')-Ib, blaTEM-1C, aph(6)-Id
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -