Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   103080
Name   oriT_pEC3II_1 in_silico
Organism   Escherichia coli
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_KU932022 (3086..3138 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pEC3II_1
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   2023 GenBank   WP_181365836
Name   t4cp2_HTH58_RS00165_pEC3II_1 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73294.84 Da        Isoelectric Point: 8.9020

>WP_181365836.1 type IV secretory system conjugative DNA transfer family protein [Escherichia coli]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRCVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 20104..43678

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTH58_RS00095 15505..16158 - 654 WP_000572551 hypothetical protein -
HTH58_RS00100 16170..17294 - 1125 WP_000486716 site-specific integrase -
HTH58_RS00105 17432..17587 + 156 WP_001358489 hypothetical protein -
HTH58_RS00430 17858..18079 + 222 Protein_20 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTH58_RS00115 18076..19452 - 1377 WP_000750519 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTH58_RS00120 19465..20100 - 636 WP_000934978 A24 family peptidase -
HTH58_RS00125 20104..20532 - 429 WP_001326801 lytic transglycosylase domain-containing protein virB1
HTH58_RS00130 20652..21209 - 558 WP_000095048 type 4 pilus major pilin -
HTH58_RS00135 21254..22363 - 1110 WP_000974903 type II secretion system F family protein -
HTH58_RS00140 22354..23907 - 1554 WP_000466228 ATPase, T2SS/T4P/T4SS family virB11
HTH58_RS00145 23932..24426 - 495 WP_000912555 type IV pilus biogenesis protein PilP -
HTH58_RS00150 24410..25732 - 1323 WP_010895889 type 4b pilus protein PilO2 -
HTH58_RS00155 25771..27414 - 1644 WP_001035589 PilN family type IVB pilus formation outer membrane protein -
HTH58_RS00160 27407..27925 - 519 WP_010895890 sigma 54-interacting transcriptional regulator virb4
HTH58_RS00165 27972..29930 - 1959 WP_181365836 type IV secretory system conjugative DNA transfer family protein -
HTH58_RS00170 29946..31001 - 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
HTH58_RS00175 31132..32271 - 1140 WP_000790641 TrbI/VirB10 family protein virB10
HTH58_RS00180 32261..32962 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
HTH58_RS00185 33028..33762 - 735 WP_000432283 type IV secretion system protein virB8
HTH58_RS00190 33928..36285 - 2358 WP_010895892 VirB4 family type IV secretion system protein virb4
HTH58_RS00195 36291..36611 - 321 WP_010895893 VirB3 family type IV secretion system protein virB3
HTH58_RS00200 36682..36972 - 291 WP_000865478 TrbC/VirB2 family protein virB2
HTH58_RS00205 36972..37556 - 585 WP_001177114 lytic transglycosylase domain-containing protein virB1
HTH58_RS00210 37577..37975 - 399 WP_001153669 hypothetical protein -
HTH58_RS00215 38094..38531 - 438 WP_000539665 type IV pilus biogenesis protein PilM -
HTH58_RS00220 38537..39772 - 1236 WP_000733391 toxin co-regulated pilus biosynthesis Q family protein -
HTH58_RS00225 39775..40062 - 288 WP_029785630 TrbM/KikA/MpfK family conjugal transfer protein -
HTH58_RS00230 40234..40869 - 636 WP_000835769 hypothetical protein -
HTH58_RS00235 40917..41726 + 810 WP_001005153 DUF5710 domain-containing protein -
HTH58_RS00240 41779..42033 - 255 WP_000609210 EexN family lipoprotein -
HTH58_RS00245 42036..42677 - 642 WP_001434037 type IV secretion system protein -
HTH58_RS00250 42683..43678 - 996 WP_000276068 type IV secretion system protein virB6
HTH58_RS00255 43682..43939 - 258 WP_000739144 hypothetical protein -
HTH58_RS00260 43936..44238 - 303 WP_000189499 hypothetical protein -
HTH58_RS00405 44219..44890 - 672 WP_236926545 hypothetical protein -
HTH58_RS00275 45041..45703 - 663 WP_001243159 hypothetical protein -
HTH58_RS00280 45714..45884 - 171 WP_000550721 hypothetical protein -
HTH58_RS00285 45888..46331 - 444 WP_000498521 NfeD family protein -
HTH58_RS00290 46393..47346 - 954 WP_072097371 SPFH domain-containing protein -
HTH58_RS00295 47373..47549 - 177 WP_000753050 hypothetical protein -
HTH58_RS00300 47542..47757 - 216 WP_001127357 DUF1187 family protein -
HTH58_RS00305 47750..48160 - 411 WP_181365837 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   3523 GenBank   NZ_KU932022
Plasmid name   pEC3II_1 Incompatibility group   IncI2
Plasmid size   59192 bp Coordinate of oriT [Strand]   3086..3138 [-]
Host baterium   Escherichia coli

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -