Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 103078 |
| Name | oriT_pVT553 |
| Organism | Escherichia coli strain VT55363 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_KU870627 (14035..14087 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pVT553
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 2020 | GenBank | WP_015059539 |
| Name | t4cp2_HTH31_RS00245_pVT553 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73404.02 Da Isoelectric Point: 9.4339
>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 30768..57487
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HTH31_RS00170 | 26169..26822 | - | 654 | WP_000572553 | hypothetical protein | - |
| HTH31_RS00175 | 26834..27958 | - | 1125 | WP_000486714 | site-specific integrase | - |
| HTH31_RS00180 | 28281..28436 | - | 156 | WP_001358489 | hypothetical protein | - |
| HTH31_RS00430 | 28512..28743 | + | 232 | Protein_39 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTH31_RS00185 | 28740..30116 | - | 1377 | WP_000750525 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTH31_RS00190 | 30129..30764 | - | 636 | WP_000934977 | A24 family peptidase | - |
| HTH31_RS00195 | 30768..31196 | - | 429 | WP_001326801 | lytic transglycosylase domain-containing protein | virB1 |
| HTH31_RS00200 | 31356..32330 | + | 975 | WP_012478345 | IS30-like element ISApl1 family transposase | - |
| HTH31_RS00205 | 32525..34150 | + | 1626 | WP_049589868 | phosphoethanolamine--lipid A transferase MCR-1.1 | - |
| HTH31_RS00210 | 34198..35040 | + | 843 | WP_155953968 | PAP2 family protein | - |
| HTH31_RS00215 | 34922..35758 | - | 837 | WP_236922358 | type II secretion system F family protein | - |
| HTH31_RS00220 | 35749..37287 | - | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
| HTH31_RS00225 | 37312..37806 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| HTH31_RS00230 | 37790..39112 | - | 1323 | WP_000454142 | type 4b pilus protein PilO2 | - |
| HTH31_RS00235 | 39151..40794 | - | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
| HTH31_RS00240 | 40787..41329 | - | 543 | WP_001220544 | sigma 54-interacting transcriptional regulator | virb4 |
| HTH31_RS00245 | 41376..43334 | - | 1959 | WP_015059539 | type IV secretory system conjugative DNA transfer family protein | - |
| HTH31_RS00250 | 43350..44405 | - | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| HTH31_RS00255 | 44424..45563 | - | 1140 | WP_000790640 | TrbI/VirB10 family protein | virB10 |
| HTH31_RS00260 | 45553..46254 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| HTH31_RS00265 | 46320..47054 | - | 735 | WP_000432282 | type IV secretion system protein | virB8 |
| HTH31_RS00270 | 47220..49577 | - | 2358 | WP_000548955 | VirB4 family type IV secretion system protein | virb4 |
| HTH31_RS00275 | 49583..49903 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| HTH31_RS00425 | 49974..50264 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| HTH31_RS00285 | 50264..50848 | - | 585 | WP_001177113 | lytic transglycosylase domain-containing protein | virB1 |
| HTH31_RS00290 | 50869..51267 | - | 399 | WP_001153665 | hypothetical protein | - |
| HTH31_RS00295 | 51386..51823 | - | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
| HTH31_RS00300 | 51829..53064 | - | 1236 | WP_015059538 | TcpQ domain-containing protein | - |
| HTH31_RS00305 | 53067..53366 | - | 300 | WP_000835764 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| HTH31_RS00310 | 53434..53715 | - | 282 | WP_000638823 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| HTH31_RS00315 | 53705..53956 | - | 252 | WP_000121741 | hypothetical protein | - |
| HTH31_RS00320 | 54056..54691 | - | 636 | WP_015059536 | hypothetical protein | - |
| HTH31_RS00325 | 54739..55530 | + | 792 | WP_023154636 | DUF5710 domain-containing protein | - |
| HTH31_RS00330 | 55608..55844 | - | 237 | WP_000750964 | EexN family lipoprotein | - |
| HTH31_RS00335 | 55848..56495 | - | 648 | WP_000653673 | type IV secretion system protein | - |
| HTH31_RS00340 | 56501..57487 | - | 987 | WP_001028544 | type IV secretion system protein | virB6 |
| HTH31_RS00345 | 57491..57748 | - | 258 | WP_000739144 | hypothetical protein | - |
| HTH31_RS00350 | 57745..58098 | - | 354 | WP_023154634 | hypothetical protein | - |
| HTH31_RS00355 | 58318..58764 | - | 447 | WP_001243164 | hypothetical protein | - |
| HTH31_RS00360 | 58775..58945 | - | 171 | WP_000550720 | hypothetical protein | - |
| HTH31_RS00365 | 58949..59392 | - | 444 | WP_000964331 | NfeD family protein | - |
| HTH31_RS00370 | 59766..60719 | - | 954 | WP_072089442 | SPFH domain-containing protein | - |
| HTH31_RS00375 | 60746..60922 | - | 177 | WP_000753050 | hypothetical protein | - |
| HTH31_RS00380 | 60915..61130 | - | 216 | WP_000049866 | DUF1187 family protein | - |
| HTH31_RS00385 | 61123..61629 | - | 507 | WP_001358485 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 3521 | GenBank | NZ_KU870627 |
| Plasmid name | pVT553 | Incompatibility group | IncI2 |
| Plasmid size | 62219 bp | Coordinate of oriT [Strand] | 14035..14087 [-] |
| Host baterium | Escherichia coli strain VT55363 |
Cargo genes
| Drug resistance gene | mcr-1.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |