Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   103073
Name   oriT_pmcr1_IncI2 in_silico
Organism   Escherichia coli strain SZ02
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_KU761326 (15838..15890 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pmcr1_IncI2
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   2014 GenBank   WP_072652803
Name   t4cp2_HTH10_RS00265_pmcr1_IncI2 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73374.92 Da        Isoelectric Point: 9.3476

>WP_072652803.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVIY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 35604..59627

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTH10_RS00200 31093..32217 - 1125 WP_000486716 site-specific integrase -
HTH10_RS00425 32280..32501 + 222 Protein_40 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTH10_RS00205 32896..33156 + 261 WP_029237379 hypothetical protein -
HTH10_RS00210 33514..33669 + 156 WP_001358489 hypothetical protein -
HTH10_RS00215 33666..34952 - 1287 WP_052993113 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTH10_RS00220 34965..35600 - 636 WP_000934977 A24 family peptidase -
HTH10_RS00225 35604..36086 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
HTH10_RS00230 36152..36709 - 558 WP_000095048 type 4 pilus major pilin -
HTH10_RS00235 36754..37863 - 1110 WP_000974903 type II secretion system F family protein -
HTH10_RS00240 37854..39392 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
HTH10_RS00245 39417..39911 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
HTH10_RS00250 39895..41217 - 1323 WP_000454142 type 4b pilus protein PilO2 -
HTH10_RS00255 41256..42899 - 1644 WP_063084537 PilN family type IVB pilus formation outer membrane protein -
HTH10_RS00260 42892..43428 - 537 WP_001220543 sigma 54-interacting transcriptional regulator virb4
HTH10_RS00265 43475..45433 - 1959 WP_072652803 type IV secretory system conjugative DNA transfer family protein -
HTH10_RS00270 45449..46504 - 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
HTH10_RS00275 46523..47662 - 1140 WP_000790640 TrbI/VirB10 family protein virB10
HTH10_RS00280 47652..48353 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
HTH10_RS00285 48419..49153 - 735 WP_000432282 type IV secretion system protein virB8
HTH10_RS00290 49319..51676 - 2358 WP_000548955 VirB4 family type IV secretion system protein virb4
HTH10_RS00295 51682..52002 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
HTH10_RS00300 52073..52363 - 291 WP_000865479 conjugal transfer protein -
HTH10_RS00305 52363..52947 - 585 WP_001177113 lytic transglycosylase domain-containing protein virB1
HTH10_RS00310 52968..53366 - 399 WP_001153665 hypothetical protein -
HTH10_RS00315 53485..53922 - 438 WP_000539665 type IV pilus biogenesis protein PilM -
HTH10_RS00320 53928..55163 - 1236 WP_072652802 TcpQ domain-containing protein -
HTH10_RS00325 55166..55465 - 300 WP_000835764 TrbM/KikA/MpfK family conjugal transfer protein -
HTH10_RS00330 55533..55814 - 282 WP_000638823 type II toxin-antitoxin system RelE/ParE family toxin -
HTH10_RS00335 55804..56055 - 252 WP_000121741 hypothetical protein -
HTH10_RS00340 56155..56790 - 636 WP_015059536 hypothetical protein -
HTH10_RS00345 56838..57629 + 792 WP_226102801 DUF5710 domain-containing protein -
HTH10_RS00350 57737..57982 - 246 WP_063080371 EexN family lipoprotein -
HTH10_RS00355 57982..58623 - 642 WP_062897948 type IV secretion system protein -
HTH10_RS00360 58629..59627 - 999 WP_063084539 type IV secretion system protein virB6
HTH10_RS00365 59631..59888 - 258 WP_000739144 hypothetical protein -
HTH10_RS00370 59885..60187 - 303 WP_001360345 hypothetical protein -
HTH10_RS00375 60203..60454 - 252 WP_236904241 hypothetical protein -
HTH10_RS00380 60451..60633 - 183 WP_022540746 hypothetical protein -
HTH10_RS00385 60602..61297 - 696 WP_021503155 yhbB protein -
HTH10_RS00390 61308..61478 - 171 WP_000550721 hypothetical protein -
HTH10_RS00395 61482..61925 - 444 WP_000964333 NfeD family protein -
HTH10_RS00400 61928..62182 - 255 WP_024181945 hypothetical protein -
HTH10_RS00405 62305..63258 - 954 WP_072652804 SPFH domain-containing protein -
HTH10_RS00410 63285..63461 - 177 WP_045146385 hypothetical protein -
HTH10_RS00415 63454..63669 - 216 WP_001127357 DUF1187 family protein -
HTH10_RS00420 63662..64168 - 507 WP_001326595 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   3516 GenBank   NZ_KU761326
Plasmid name   pmcr1_IncI2 Incompatibility group   IncI2
Plasmid size   64964 bp Coordinate of oriT [Strand]   15838..15890 [-]
Host baterium   Escherichia coli strain SZ02

Cargo genes


Drug resistance gene   mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -