Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 103064 |
| Name | oriT_pWF-5-19C_mcr-1  |
| Organism | Cronobacter sakazakii strain WF-5-19C |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_KX505142 (15838..15890 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pWF-5-19C_mcr-1
CACACGATTGTAACATGACCGGAACGGTCTTGTGTTCAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTTCAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 2003 | GenBank | WP_072652803 |
| Name | t4cp2_HTJ23_RS00260_pWF-5-19C_mcr-1 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73374.92 Da Isoelectric Point: 9.3476
>WP_072652803.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVIY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVIY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 35842..59866
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HTJ23_RS00190 | 31318..32442 | - | 1125 | WP_000486716 | site-specific integrase | - |
| HTJ23_RS00450 | 32505..32726 | + | 222 | Protein_40 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTJ23_RS00200 | 33121..33381 | + | 261 | WP_029237379 | hypothetical protein | - |
| HTJ23_RS00205 | 33740..33895 | + | 156 | WP_001358489 | hypothetical protein | - |
| HTJ23_RS00210 | 33892..35190 | - | 1299 | WP_172688744 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTJ23_RS00215 | 35203..35838 | - | 636 | WP_000934978 | A24 family peptidase | - |
| HTJ23_RS00220 | 35842..36270 | - | 429 | WP_001326801 | lytic transglycosylase domain-containing protein | virB1 |
| HTJ23_RS00225 | 36391..36948 | - | 558 | WP_000095049 | type 4 pilus major pilin | - |
| HTJ23_RS00230 | 36993..38102 | - | 1110 | WP_000974902 | type II secretion system F family protein | - |
| HTJ23_RS00235 | 38093..39631 | - | 1539 | WP_000466227 | ATPase, T2SS/T4P/T4SS family | virB11 |
| HTJ23_RS00240 | 39656..40150 | - | 495 | WP_020245536 | type IV pilus biogenesis protein PilP | - |
| HTJ23_RS00245 | 40134..41456 | - | 1323 | WP_000454142 | type 4b pilus protein PilO2 | - |
| HTJ23_RS00250 | 41495..43138 | - | 1644 | WP_063084537 | PilN family type IVB pilus formation outer membrane protein | - |
| HTJ23_RS00255 | 43131..43667 | - | 537 | WP_001220543 | sigma 54-interacting transcriptional regulator | virb4 |
| HTJ23_RS00260 | 43714..45672 | - | 1959 | WP_072652803 | type IV secretory system conjugative DNA transfer family protein | - |
| HTJ23_RS00265 | 45688..46743 | - | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| HTJ23_RS00270 | 46762..47901 | - | 1140 | WP_000790640 | TrbI/VirB10 family protein | virB10 |
| HTJ23_RS00275 | 47891..48592 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| HTJ23_RS00280 | 48658..49392 | - | 735 | WP_000432282 | type IV secretion system protein | virB8 |
| HTJ23_RS00285 | 49558..51915 | - | 2358 | WP_000548955 | VirB4 family type IV secretion system protein | virb4 |
| HTJ23_RS00290 | 51921..52241 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| HTJ23_RS00445 | 52312..52602 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| HTJ23_RS00300 | 52602..53186 | - | 585 | WP_001177113 | lytic transglycosylase domain-containing protein | virB1 |
| HTJ23_RS00305 | 53207..53605 | - | 399 | WP_001153665 | hypothetical protein | - |
| HTJ23_RS00310 | 53724..54161 | - | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
| HTJ23_RS00315 | 54167..55402 | - | 1236 | WP_072652802 | TcpQ domain-containing protein | - |
| HTJ23_RS00320 | 55405..55704 | - | 300 | WP_000835764 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| HTJ23_RS00325 | 55772..56053 | - | 282 | WP_000638823 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| HTJ23_RS00330 | 56043..56294 | - | 252 | WP_000121741 | hypothetical protein | - |
| HTJ23_RS00335 | 56394..57029 | - | 636 | WP_015059536 | hypothetical protein | - |
| HTJ23_RS00340 | 57077..57868 | + | 792 | WP_226102801 | DUF5710 domain-containing protein | - |
| HTJ23_RS00345 | 57976..58221 | - | 246 | WP_063080371 | EexN family lipoprotein | - |
| HTJ23_RS00350 | 58221..58862 | - | 642 | WP_062897948 | type IV secretion system protein | - |
| HTJ23_RS00355 | 58868..59866 | - | 999 | WP_063084539 | type IV secretion system protein | virB6 |
| HTJ23_RS00360 | 59870..60127 | - | 258 | WP_000739144 | hypothetical protein | - |
| HTJ23_RS00365 | 60124..60426 | - | 303 | WP_001360345 | hypothetical protein | - |
| HTJ23_RS00370 | 60442..60693 | - | 252 | WP_236904241 | hypothetical protein | - |
| HTJ23_RS00375 | 60690..60872 | - | 183 | WP_022540746 | hypothetical protein | - |
| HTJ23_RS00380 | 60841..61536 | - | 696 | WP_021503155 | yhbB protein | - |
| HTJ23_RS00385 | 61547..61717 | - | 171 | WP_000550721 | hypothetical protein | - |
| HTJ23_RS00390 | 61721..62164 | - | 444 | WP_000964333 | NfeD family protein | - |
| HTJ23_RS00395 | 62167..62421 | - | 255 | WP_024181945 | hypothetical protein | - |
| HTJ23_RS00400 | 62544..63497 | - | 954 | WP_072652804 | SPFH domain-containing protein | - |
| HTJ23_RS00405 | 63524..63700 | - | 177 | WP_045146385 | hypothetical protein | - |
| HTJ23_RS00410 | 63693..63908 | - | 216 | WP_001127357 | DUF1187 family protein | - |
| HTJ23_RS00415 | 63901..64407 | - | 507 | WP_001326595 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 3507 | GenBank | NZ_KX505142 |
| Plasmid name | pWF-5-19C_mcr-1 | Incompatibility group | IncI2 |
| Plasmid size | 65203 bp | Coordinate of oriT [Strand] | 15838..15890 [-] |
| Host baterium | Cronobacter sakazakii strain WF-5-19C |
Cargo genes
| Drug resistance gene | mcr-1.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |