Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   103044
Name   oriT_FWSEC0112|unnamed2 in_silico
Organism   Escherichia coli strain FWSEC0112
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_RRGD01000120 (43756..43809 [-], 54 nt)
oriT length   54 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 54 nt

>oriT_FWSEC0112|unnamed2
CACAAGCATTGTAACATGCCCGGAACGTGCTTGTGTACAAAGCTTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1977 GenBank   WP_086260088
Name   t4cp2_C9Z62_RS27045_FWSEC0112|unnamed2 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73419.95 Da        Isoelectric Point: 9.0081

>WP_086260088.1 type IV secretory system conjugative DNA transfer family protein [Escherichia coli]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLELYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1687..25040

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C9Z62_RS26995 (C9Z62_27055) 1..1035 - 1035 WP_000750512 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
C9Z62_RS27000 (C9Z62_27060) 1048..1683 - 636 WP_000934979 A24 family peptidase -
C9Z62_RS27005 (C9Z62_27065) 1687..2169 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
C9Z62_RS27010 (C9Z62_27070) 2235..2792 - 558 WP_000095048 type 4 pilus major pilin -
C9Z62_RS27015 (C9Z62_27075) 2837..3946 - 1110 WP_000974903 type II secretion system F family protein -
C9Z62_RS27020 (C9Z62_27080) 3937..5475 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
C9Z62_RS27025 (C9Z62_27085) 5500..5994 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
C9Z62_RS27030 (C9Z62_27090) 5978..7288 - 1311 WP_001454111 type 4b pilus protein PilO2 -
C9Z62_RS27035 (C9Z62_27095) 7339..8982 - 1644 WP_001035589 PilN family type IVB pilus formation outer membrane protein -
C9Z62_RS27040 (C9Z62_27100) 8975..9505 - 531 WP_001220542 sigma 54-interacting transcriptional regulator virb4
C9Z62_RS27045 (C9Z62_27105) 9552..11510 - 1959 WP_086260088 type IV secretory system conjugative DNA transfer family protein -
C9Z62_RS27050 (C9Z62_27110) 11526..12581 - 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
C9Z62_RS27055 (C9Z62_27115) 12600..13739 - 1140 WP_000790641 TrbI/VirB10 family protein virB10
C9Z62_RS27060 (C9Z62_27120) 13729..14430 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
C9Z62_RS27065 (C9Z62_27125) 14496..15230 - 735 WP_000432283 type IV secretion system protein virB8
C9Z62_RS27075 (C9Z62_27135) 15396..17753 - 2358 WP_000548950 VirB4 family type IV secretion system protein virb4
C9Z62_RS27080 (C9Z62_27140) 17759..18079 - 321 WP_086260089 VirB3 family type IV secretion system protein virB3
C9Z62_RS28345 18150..18440 - 291 WP_000865479 conjugal transfer protein -
C9Z62_RS27090 (C9Z62_27150) 18440..19024 - 585 WP_001177114 lytic transglycosylase domain-containing protein virB1
C9Z62_RS27095 (C9Z62_27155) 19045..19443 - 399 WP_001153669 hypothetical protein -
C9Z62_RS27100 (C9Z62_27160) 19562..19999 - 438 WP_000539665 type IV pilus biogenesis protein PilM -
C9Z62_RS27105 (C9Z62_27165) 20005..21240 - 1236 WP_063112255 TcpQ domain-containing protein -
C9Z62_RS27110 (C9Z62_27170) 21243..21542 - 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
C9Z62_RS27115 (C9Z62_27175) 21609..22244 - 636 WP_077135686 hypothetical protein -
C9Z62_RS27120 (C9Z62_27180) 22325..23083 + 759 WP_224482110 DUF5710 domain-containing protein -
C9Z62_RS27125 (C9Z62_27185) 23161..23397 - 237 WP_000750964 EexN family lipoprotein -
C9Z62_RS27130 (C9Z62_27190) 23401..24048 - 648 WP_086260090 type IV secretion system protein -
C9Z62_RS27135 (C9Z62_27195) 24054..25040 - 987 WP_001028544 type IV secretion system protein virB6
C9Z62_RS27140 (C9Z62_27200) 25044..25301 - 258 WP_000739144 hypothetical protein -
C9Z62_RS27145 (C9Z62_27205) 25298..25600 - 303 WP_077135687 hypothetical protein -
C9Z62_RS27150 (C9Z62_27210) 25581..25838 - 258 WP_001542015 hypothetical protein -
C9Z62_RS27155 (C9Z62_27215) 25872..26525 - 654 WP_021580487 hypothetical protein -
C9Z62_RS27625 26536..26706 - 171 WP_000550721 hypothetical protein -
C9Z62_RS27160 (C9Z62_27220) 26710..27153 - 444 WP_000498521 NfeD family protein -
C9Z62_RS27165 (C9Z62_27225) 27215..28168 - 954 WP_072113668 SPFH domain-containing protein -
C9Z62_RS27170 (C9Z62_27230) 28214..28408 - 195 WP_086260091 DUF1187 family protein -
C9Z62_RS27175 (C9Z62_27235) 28401..28853 - 453 WP_000101552 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   3487 GenBank   NZ_RRGD01000120
Plasmid name   FWSEC0112|unnamed2 Incompatibility group   IncI2
Plasmid size   57781 bp Coordinate of oriT [Strand]   43756..43809 [-]
Host baterium   Escherichia coli strain FWSEC0112

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -