Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 103038 |
| Name | oriT_pECJS-61-63  |
| Organism | Escherichia coli strain 61 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_KX084393 (55584..55636 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pECJS-61-63
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 1970 | GenBank | WP_015059539 |
| Name | t4cp2_HTH79_RS00100_pECJS-61-63 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73404.02 Da Isoelectric Point: 9.4339
>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 10841..34991
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HTH79_RS00035 | 6330..7454 | - | 1125 | WP_000486716 | site-specific integrase | - |
| HTH79_RS00040 | 7777..7932 | - | 156 | WP_001358489 | hypothetical protein | - |
| HTH79_RS00425 | 8033..8239 | + | 207 | Protein_8 | prepilin | - |
| HTH79_RS00050 | 8903..10189 | - | 1287 | WP_015057162 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTH79_RS00055 | 10202..10837 | - | 636 | WP_000934977 | A24 family peptidase | - |
| HTH79_RS00060 | 10841..11323 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| HTH79_RS00065 | 11389..11946 | - | 558 | WP_000095048 | type 4 pilus major pilin | - |
| HTH79_RS00070 | 11991..13100 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
| HTH79_RS00075 | 13091..14629 | - | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
| HTH79_RS00080 | 14654..15148 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| HTH79_RS00085 | 15132..16454 | - | 1323 | WP_000454142 | type 4b pilus protein PilO2 | - |
| HTH79_RS00090 | 16493..18136 | - | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
| HTH79_RS00095 | 18129..18671 | - | 543 | WP_001220544 | sigma 54-interacting transcriptional regulator | virb4 |
| HTH79_RS00100 | 18718..20676 | - | 1959 | WP_015059539 | type IV secretory system conjugative DNA transfer family protein | - |
| HTH79_RS00105 | 20692..21747 | - | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| HTH79_RS00110 | 21766..22905 | - | 1140 | WP_000790640 | TrbI/VirB10 family protein | virB10 |
| HTH79_RS00115 | 22895..23596 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| HTH79_RS00120 | 23662..24396 | - | 735 | WP_000432282 | type IV secretion system protein | virB8 |
| HTH79_RS00125 | 24562..26919 | - | 2358 | WP_063078682 | VirB4 family type IV secretion system protein | virb4 |
| HTH79_RS00130 | 26925..27245 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| HTH79_RS00400 | 27316..27606 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| HTH79_RS00140 | 27606..28190 | - | 585 | WP_001177113 | lytic transglycosylase domain-containing protein | virB1 |
| HTH79_RS00145 | 28211..28609 | - | 399 | WP_001153665 | hypothetical protein | - |
| HTH79_RS00150 | 28728..29165 | - | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
| HTH79_RS00155 | 29171..30406 | - | 1236 | WP_015059538 | TcpQ domain-containing protein | - |
| HTH79_RS00160 | 30409..30708 | - | 300 | WP_000835764 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| HTH79_RS00165 | 30776..31057 | - | 282 | WP_000638823 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| HTH79_RS00170 | 31047..31298 | - | 252 | WP_000121741 | hypothetical protein | - |
| HTH79_RS00175 | 31398..32033 | - | 636 | WP_015059536 | hypothetical protein | - |
| HTH79_RS00180 | 32177..32890 | + | 714 | WP_065304452 | DUF5710 domain-containing protein | - |
| HTH79_RS00185 | 33113..33337 | - | 225 | WP_065304445 | EexN family lipoprotein | - |
| HTH79_RS00190 | 33346..33990 | - | 645 | WP_065304453 | type IV secretion system protein | - |
| HTH79_RS00195 | 33996..34991 | - | 996 | WP_065304446 | type IV secretion system protein | virB6 |
| HTH79_RS00200 | 34995..35252 | - | 258 | WP_000739144 | hypothetical protein | - |
| HTH79_RS00205 | 35249..35602 | - | 354 | WP_223286767 | hypothetical protein | - |
| HTH79_RS00210 | 35822..36268 | - | 447 | WP_001243165 | hypothetical protein | - |
| HTH79_RS00215 | 36279..36449 | - | 171 | WP_000550720 | hypothetical protein | - |
| HTH79_RS00220 | 36453..36896 | - | 444 | WP_072652571 | NfeD family protein | - |
| HTH79_RS00225 | 37270..38223 | - | 954 | WP_072652574 | SPFH domain-containing protein | - |
| HTH79_RS00230 | 38269..38463 | - | 195 | WP_001127356 | DUF1187 family protein | - |
| HTH79_RS00235 | 38456..38962 | - | 507 | WP_001326595 | CaiF/GrlA family transcriptional regulator | - |
| HTH79_RS00240 | 39606..39938 | - | 333 | WP_172687995 | hypothetical protein | - |
Host bacterium
| ID | 3481 | GenBank | NZ_KX084393 |
| Plasmid name | pECJS-61-63 | Incompatibility group | IncI2 |
| Plasmid size | 63656 bp | Coordinate of oriT [Strand] | 55584..55636 [-] |
| Host baterium | Escherichia coli strain 61 |
Cargo genes
| Drug resistance gene | mcr-1.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |