Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 103034 |
| Name | oriT_pECJS-61-63  |
| Organism | Escherichia coli strain JS-61 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_KX254342 (15631..15683 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pECJS-61-63
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 1964 | GenBank | WP_015059539 |
| Name | t4cp2_HTI03_RS00250_pECJS-61-63 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73404.02 Da Isoelectric Point: 9.4339
>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 34544..58694
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HTI03_RS00185 | 30033..31157 | - | 1125 | WP_000486716 | site-specific integrase | - |
| HTI03_RS00190 | 31480..31635 | - | 156 | WP_001358489 | hypothetical protein | - |
| HTI03_RS00425 | 31736..31942 | + | 207 | Protein_40 | prepilin | - |
| HTI03_RS00200 | 32606..33892 | - | 1287 | WP_015057162 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTI03_RS00205 | 33905..34540 | - | 636 | WP_000934977 | A24 family peptidase | - |
| HTI03_RS00210 | 34544..35026 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| HTI03_RS00215 | 35092..35649 | - | 558 | WP_000095048 | type 4 pilus major pilin | - |
| HTI03_RS00220 | 35694..36803 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
| HTI03_RS00225 | 36794..38332 | - | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
| HTI03_RS00230 | 38357..38851 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| HTI03_RS00235 | 38835..40157 | - | 1323 | WP_000454142 | type 4b pilus protein PilO2 | - |
| HTI03_RS00240 | 40196..41839 | - | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
| HTI03_RS00245 | 41832..42374 | - | 543 | WP_001220544 | sigma 54-interacting transcriptional regulator | virb4 |
| HTI03_RS00250 | 42421..44379 | - | 1959 | WP_015059539 | type IV secretory system conjugative DNA transfer family protein | - |
| HTI03_RS00255 | 44395..45450 | - | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| HTI03_RS00260 | 45469..46608 | - | 1140 | WP_000790640 | TrbI/VirB10 family protein | virB10 |
| HTI03_RS00265 | 46598..47299 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| HTI03_RS00270 | 47365..48099 | - | 735 | WP_000432282 | type IV secretion system protein | virB8 |
| HTI03_RS00275 | 48265..50622 | - | 2358 | WP_063078682 | VirB4 family type IV secretion system protein | virb4 |
| HTI03_RS00280 | 50628..50948 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| HTI03_RS00420 | 51019..51309 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| HTI03_RS00290 | 51309..51893 | - | 585 | WP_001177113 | lytic transglycosylase domain-containing protein | virB1 |
| HTI03_RS00295 | 51914..52312 | - | 399 | WP_001153665 | hypothetical protein | - |
| HTI03_RS00300 | 52431..52868 | - | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
| HTI03_RS00305 | 52874..54109 | - | 1236 | WP_015059538 | TcpQ domain-containing protein | - |
| HTI03_RS00310 | 54112..54411 | - | 300 | WP_000835764 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| HTI03_RS00315 | 54479..54760 | - | 282 | WP_000638823 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| HTI03_RS00320 | 54750..55001 | - | 252 | WP_000121741 | hypothetical protein | - |
| HTI03_RS00325 | 55101..55736 | - | 636 | WP_015059536 | hypothetical protein | - |
| HTI03_RS00330 | 55880..56593 | + | 714 | WP_065304452 | DUF5710 domain-containing protein | - |
| HTI03_RS00335 | 56816..57040 | - | 225 | WP_065304445 | EexN family lipoprotein | - |
| HTI03_RS00340 | 57049..57693 | - | 645 | WP_065304453 | type IV secretion system protein | - |
| HTI03_RS00345 | 57699..58694 | - | 996 | WP_065304446 | type IV secretion system protein | virB6 |
| HTI03_RS00350 | 58698..58955 | - | 258 | WP_000739144 | hypothetical protein | - |
| HTI03_RS00355 | 58952..59305 | - | 354 | WP_223286767 | hypothetical protein | - |
| HTI03_RS00360 | 59525..59971 | - | 447 | WP_001243165 | hypothetical protein | - |
| HTI03_RS00365 | 59982..60152 | - | 171 | WP_000550720 | hypothetical protein | - |
| HTI03_RS00370 | 60156..60599 | - | 444 | WP_072652571 | NfeD family protein | - |
| HTI03_RS00375 | 60973..61926 | - | 954 | WP_072652574 | SPFH domain-containing protein | - |
| HTI03_RS00380 | 61972..62166 | - | 195 | WP_001127356 | DUF1187 family protein | - |
| HTI03_RS00385 | 62159..62665 | - | 507 | WP_001326595 | CaiF/GrlA family transcriptional regulator | - |
| HTI03_RS00390 | 63309..63641 | - | 333 | WP_172687995 | hypothetical protein | - |
Host bacterium
| ID | 3477 | GenBank | NZ_KX254342 |
| Plasmid name | pECJS-61-63 | Incompatibility group | - |
| Plasmid size | 63656 bp | Coordinate of oriT [Strand] | 15631..15683 [-] |
| Host baterium | Escherichia coli strain JS-61 |
Cargo genes
| Drug resistance gene | mcr-1.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |