Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 103031 |
| Name | oriT_pAF23 |
| Organism | Escherichia coli strain Af23 isolate A |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_KX032519 (13680..13732 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pAF23
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 1960 | GenBank | WP_015059539 |
| Name | t4cp2_HTH80_RS00230_pAF23 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73404.02 Da Isoelectric Point: 9.4339
>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 32988..56445
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HTH80_RS00165 | 28489..29142 | - | 654 | WP_170855322 | hypothetical protein | - |
| HTH80_RS00170 | 29154..30278 | - | 1125 | WP_000486716 | site-specific integrase | - |
| HTH80_RS00410 | 30341..30562 | + | 222 | Protein_37 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTH80_RS00180 | 31195..31455 | - | 261 | WP_029237379 | hypothetical protein | - |
| HTH80_RS00185 | 31583..32811 | + | 1229 | WP_113708090 | IS3-like element IS2 family transposase | - |
| HTH80_RS00190 | 32988..33470 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| HTH80_RS00195 | 33536..34093 | - | 558 | WP_000095048 | type 4 pilus major pilin | - |
| HTH80_RS00200 | 34138..35247 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
| HTH80_RS00205 | 35238..36776 | - | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
| HTH80_RS00210 | 36801..37295 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| HTH80_RS00215 | 37279..38601 | - | 1323 | WP_000454142 | type 4b pilus protein PilO2 | - |
| HTH80_RS00220 | 38640..40283 | - | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
| HTH80_RS00225 | 40276..40812 | - | 537 | WP_001220543 | sigma 54-interacting transcriptional regulator | virb4 |
| HTH80_RS00230 | 40859..42817 | - | 1959 | WP_015059539 | type IV secretory system conjugative DNA transfer family protein | - |
| HTH80_RS00235 | 42833..43888 | - | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| HTH80_RS00240 | 43907..45046 | - | 1140 | WP_000790640 | TrbI/VirB10 family protein | virB10 |
| HTH80_RS00245 | 45036..45737 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| HTH80_RS00250 | 45803..46537 | - | 735 | WP_000432282 | type IV secretion system protein | virB8 |
| HTH80_RS00255 | 46703..49060 | - | 2358 | WP_063078682 | VirB4 family type IV secretion system protein | virb4 |
| HTH80_RS00260 | 49066..49386 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| HTH80_RS00395 | 49457..49747 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| HTH80_RS00270 | 49747..50331 | - | 585 | WP_001177113 | lytic transglycosylase domain-containing protein | virB1 |
| HTH80_RS00275 | 50352..50750 | - | 399 | WP_001153665 | hypothetical protein | - |
| HTH80_RS00280 | 50869..51306 | - | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
| HTH80_RS00285 | 51312..52547 | - | 1236 | WP_015059538 | TcpQ domain-containing protein | - |
| HTH80_RS00290 | 52550..52849 | - | 300 | WP_000835764 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| HTH80_RS00295 | 52917..53198 | - | 282 | WP_000638823 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| HTH80_RS00300 | 53188..53439 | - | 252 | WP_000121741 | hypothetical protein | - |
| HTH80_RS00305 | 53539..54174 | - | 636 | WP_015059536 | hypothetical protein | - |
| HTH80_RS00310 | 54247..54534 | - | 288 | WP_001032611 | EexN family lipoprotein | - |
| HTH80_RS00315 | 54547..54801 | - | 255 | WP_001043555 | EexN family lipoprotein | - |
| HTH80_RS00320 | 54803..55444 | - | 642 | WP_001425343 | type IV secretion system protein | - |
| HTH80_RS00325 | 55450..56445 | - | 996 | WP_001028543 | type IV secretion system protein | virB6 |
| HTH80_RS00330 | 56449..56706 | - | 258 | WP_000739144 | hypothetical protein | - |
| HTH80_RS00335 | 56703..57056 | - | 354 | WP_223286767 | hypothetical protein | - |
| HTH80_RS00340 | 57276..57722 | - | 447 | WP_001243165 | hypothetical protein | - |
| HTH80_RS00345 | 57733..57903 | - | 171 | WP_000550720 | hypothetical protein | - |
| HTH80_RS00350 | 57907..58350 | - | 444 | WP_000964330 | NfeD family protein | - |
| HTH80_RS00355 | 58724..59677 | - | 954 | WP_072089442 | SPFH domain-containing protein | - |
| HTH80_RS00360 | 59704..59880 | - | 177 | WP_000753050 | hypothetical protein | - |
| HTH80_RS00365 | 59873..60088 | - | 216 | WP_001127357 | DUF1187 family protein | - |
| HTH80_RS00370 | 60081..60587 | - | 507 | WP_001326595 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 3474 | GenBank | NZ_KX032519 |
| Plasmid name | pAF23 | Incompatibility group | IncI2 |
| Plasmid size | 61177 bp | Coordinate of oriT [Strand] | 13680..13732 [-] |
| Host baterium | Escherichia coli strain Af23 isolate A |
Cargo genes
| Drug resistance gene | mcr-1.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |