Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103028
Name   oriT_pEC14I in_silico
Organism   Escherichia coli
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_KU932025 (113941..114292 [+], 352 nt)
oriT length   352 nt
IRs (inverted repeats)      255..262, 271..278  (ACCGCTAG..CTAGCGGT)
 192..198, 206..212  (TATAAAA..TTTTATA)
 40..47, 50..57  (GCAAAAAC..GTTTTTGC)
 4..11, 16..23  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 352 nt

>oriT_pEC14I
AGGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTTTCTTTATAAATAGAGTGTTATGAAAAATTAGTTTCTCTTACTCTCTTTATGATATTTAAAAAAGCGGTGTCGGCGCGGCTACAACAACGCGCCGACACCGTTTTGTAGGGGTGGTACTGACTATTTTTATAAAAAACATTATTTTATATTAGGGGTGCTGCTAGCGGCGCGGTGTGTTTTTTTATAGGATACCGCTAGGGGCGCTGCTAGCGGTGCGTCCCTGTTTGCATTATGAATTTTAGTGTTTCGAAATTAACTTTATTTTATGTTCAAAAAAGGTAATCTCTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   926 GenBank   WP_001151524
Name   WP_001151524_pEC14I insolico UniProt ID   A0A5W2DT22
Length   127 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 127 a.a.        Molecular weight: 14517.48 Da        Isoelectric Point: 5.0516

>WP_001151524.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Gammaproteobacteria]
MAKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQMERKESAFNQTEFNKLL
LECVVKTQSSVAKILGIESLSPHVSGNPKFEYANMVEDIREKVSSEMERFFPKNDDE

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-126)


  Protein structure


Source ID Structure
AlphaFold DB A0A5W2DT22

ID   927 GenBank   WP_000239828
Name   WP_000239828_pEC14I insolico UniProt ID   B1P7U1
Length   119 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 119 a.a.        Molecular weight: 13861.82 Da        Isoelectric Point: 8.0399

>WP_000239828.1 MULTISPECIES: conjugal transfer relaxosome DNA-bindin protein TraY [Gammaproteobacteria]
MVKLKLPVDVESLLIEASNRSGRSRSFEAVIRLKDHLHRYPKFNRAGNIYGKSLVKYLTMRLDDETNQLL
IAAKNRSGWCKTDEAADRVIDHLIKFPDFYNSEIFREADKEEDITFNTL

  Protein domains


Predicted by InterproScan.

TraY domain (TraY)

(3-47)

TraY domain (TraY)

(58-105)


  Protein structure


Source ID Structure
AlphaFold DB B1P7U1


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 113370..138015

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTH75_RS00595 109334..109768 + 435 WP_000845895 conjugation system SOS inhibitor PsiB -
HTH75_RS00600 109765..110527 + 763 Protein_120 plasmid SOS inhibition protein A -
HTH75_RS00840 110706..110855 + 150 Protein_121 plasmid maintenance protein Mok -
HTH75_RS00605 110797..110922 + 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
HTH75_RS00845 111142..111372 + 231 WP_001426396 hypothetical protein -
HTH75_RS00850 111370..111543 - 174 Protein_124 hypothetical protein -
HTH75_RS00610 111613..111819 + 207 WP_000547939 hypothetical protein -
HTH75_RS00615 111844..112131 + 288 WP_000107535 hypothetical protein -
HTH75_RS00620 112252..113073 + 822 WP_001234469 DUF932 domain-containing protein -
HTH75_RS00625 113370..113972 - 603 WP_000243709 transglycosylase SLT domain-containing protein virB1
HTH75_RS00630 114293..114676 + 384 WP_001151524 conjugal transfer relaxosome DNA-binding protein TraM -
HTH75_RS00635 114863..115552 + 690 WP_000283385 conjugal transfer transcriptional regulator TraJ -
HTH75_RS00640 115651..116046 + 396 WP_001309237 conjugal transfer relaxosome DNA-bindin protein TraY -
HTH75_RS00645 116079..116444 + 366 WP_000994779 type IV conjugative transfer system pilin TraA -
HTH75_RS00650 116459..116770 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
HTH75_RS00655 116792..117358 + 567 WP_000399792 type IV conjugative transfer system protein TraE traE
HTH75_RS00660 117345..118073 + 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
HTH75_RS00665 118073..119500 + 1428 WP_000146692 F-type conjugal transfer pilus assembly protein TraB traB
HTH75_RS00670 119490..120080 + 591 WP_000002792 conjugal transfer pilus-stabilizing protein TraP -
HTH75_RS00675 120067..120264 + 198 WP_001324648 conjugal transfer protein TrbD -
HTH75_RS00680 120276..120527 + 252 WP_112793653 conjugal transfer protein TrbG -
HTH75_RS00685 120524..121039 + 516 WP_000809841 type IV conjugative transfer system lipoprotein TraV traV
HTH75_RS00690 121174..121395 + 222 WP_001278689 conjugal transfer protein TraR -
HTH75_RS00695 121555..121692 + 138 WP_236926561 hypothetical protein -
HTH75_RS00700 121736..122518 - 783 WP_001300609 IS21-like element IS100kyp family helper ATPase IstB -
HTH75_RS00705 122515..123537 - 1023 WP_000255944 IS21-like element IS100 family transposase -
HTH75_RS00710 123625..126141 + 2517 Protein_145 type IV secretion system protein TraC -
HTH75_RS00715 126138..126524 + 387 WP_000097319 type-F conjugative transfer system protein TrbI -
HTH75_RS00720 126521..127153 + 633 WP_001203720 type-F conjugative transfer system protein TraW traW
HTH75_RS00725 127150..128142 + 993 WP_000830187 conjugal transfer pilus assembly protein TraU traU
HTH75_RS00730 128151..128789 + 639 WP_000777688 type-F conjugative transfer system pilin assembly protein TrbC trbC
HTH75_RS00735 128786..130594 + 1809 WP_000821847 type-F conjugative transfer system mating-pair stabilization protein TraN traN
HTH75_RS00740 130621..130878 + 258 WP_000864318 conjugal transfer protein TrbE -
HTH75_RS00745 130871..131614 + 744 WP_001030367 type-F conjugative transfer system pilin assembly protein TraF traF
HTH75_RS00750 131630..131977 + 348 WP_001287913 conjugal transfer protein TrbA -
HTH75_RS00755 131979..132293 - 315 WP_000415567 hypothetical protein -
HTH75_RS00760 132374..132658 + 285 WP_000624109 type-F conjugative transfer system pilin chaperone TraQ -
HTH75_RS00765 132645..133190 + 546 WP_000059850 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
HTH75_RS00770 133120..133461 + 342 WP_001443031 P-type conjugative transfer protein TrbJ -
HTH75_RS00775 133448..133829 + 382 Protein_158 F-type conjugal transfer protein TrbF -
HTH75_RS00780 133829..135202 + 1374 WP_021553026 conjugal transfer pilus assembly protein TraH traH
HTH75_RS00785 135199..138015 + 2817 WP_001007054 conjugal transfer mating-pair stabilization protein TraG traG
HTH75_RS00790 138048..138569 + 522 WP_000632670 conjugal transfer entry exclusion protein TraS -
HTH75_RS00795 138594..139325 + 732 WP_000850422 conjugal transfer complement resistance protein TraT -
HTH75_RS00800 139578..141413 + 1836 Protein_163 type IV conjugative transfer system coupling protein TraD -
HTH75_RS00805 141466..142143 + 678 WP_001339397 IS66-like element accessory protein TnpA -
HTH75_RS00810 142143..142490 + 348 WP_000624622 IS66 family insertion sequence element accessory protein TnpB -

Host bacterium

ID   3471 GenBank   NZ_KU932025
Plasmid name   pEC14I Incompatibility group   IncFIB
Plasmid size   143590 bp Coordinate of oriT [Strand]   113941..114292 [+]
Host baterium   Escherichia coli

Cargo genes

Drug resistance gene   blaTEM-1B, sul2, aph(3'')-Ib, aph(6)-Id, dfrA1, ant(3'')-Ia, qacE, sul1, mph(B), tet(A), sitABCD
Virulence gene   iroN, iroE, iroD, iroC, iroB
Metal resistance gene   merE, merD, merA, merP, merT, merR
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -