Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 103018 |
Name | oriT_pHeN867 |
Organism | Escherichia coli strain HeN867 |
Sequence Completeness | - |
NCBI accession of oriT (coordinates [strand]) | NZ_KU934208 (13631..13683 [-], 53 nt) |
oriT length | 53 nt |
IRs (inverted repeats) | _ |
Location of nic site | _ |
Conserved sequence flanking the nic site |
_ |
Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pHeN867
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileT4CP
ID | 1951 | GenBank | WP_015059539 |
Name | t4cp2_HTI70_RS00235_pHeN867 | UniProt ID | _ |
Length | 652 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73404.02 Da Isoelectric Point: 9.4339
>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 32568..56025
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HTI70_RS00170 | 28051..29175 | - | 1125 | WP_000486716 | site-specific integrase | - |
HTI70_RS00175 | 29504..29659 | - | 156 | WP_001358489 | hypothetical protein | - |
HTI70_RS00180 | 30017..30277 | - | 261 | WP_029237379 | hypothetical protein | - |
HTI70_RS00185 | 30672..31916 | - | 1245 | WP_000750517 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
HTI70_RS00190 | 31929..32564 | - | 636 | WP_000934977 | A24 family peptidase | - |
HTI70_RS00195 | 32568..33050 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
HTI70_RS00200 | 33116..33673 | - | 558 | WP_000095048 | type 4 pilus major pilin | - |
HTI70_RS00205 | 33718..34827 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
HTI70_RS00210 | 34818..36356 | - | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
HTI70_RS00215 | 36381..36875 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
HTI70_RS00220 | 36859..38181 | - | 1323 | WP_000454142 | type 4b pilus protein PilO2 | - |
HTI70_RS00225 | 38220..39863 | - | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
HTI70_RS00230 | 39856..40392 | - | 537 | WP_001220543 | sigma 54-interacting transcriptional regulator | virb4 |
HTI70_RS00235 | 40439..42397 | - | 1959 | WP_015059539 | type IV secretory system conjugative DNA transfer family protein | - |
HTI70_RS00240 | 42413..43468 | - | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
HTI70_RS00245 | 43487..44626 | - | 1140 | WP_000790640 | TrbI/VirB10 family protein | virB10 |
HTI70_RS00250 | 44616..45317 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
HTI70_RS00255 | 45383..46117 | - | 735 | WP_000432282 | type IV secretion system protein | virB8 |
HTI70_RS00260 | 46283..48640 | - | 2358 | WP_063078682 | VirB4 family type IV secretion system protein | virb4 |
HTI70_RS00265 | 48646..48966 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
HTI70_RS00400 | 49037..49327 | - | 291 | WP_000865479 | conjugal transfer protein | - |
HTI70_RS00275 | 49327..49911 | - | 585 | WP_001177113 | lytic transglycosylase domain-containing protein | virB1 |
HTI70_RS00280 | 49932..50330 | - | 399 | WP_001153665 | hypothetical protein | - |
HTI70_RS00285 | 50449..50886 | - | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
HTI70_RS00290 | 50892..52127 | - | 1236 | WP_015059538 | TcpQ domain-containing protein | - |
HTI70_RS00295 | 52130..52429 | - | 300 | WP_000835764 | TrbM/KikA/MpfK family conjugal transfer protein | - |
HTI70_RS00300 | 52497..52778 | - | 282 | WP_000638823 | type II toxin-antitoxin system RelE/ParE family toxin | - |
HTI70_RS00305 | 52768..53019 | - | 252 | WP_000121741 | hypothetical protein | - |
HTI70_RS00310 | 53119..53754 | - | 636 | WP_015059536 | hypothetical protein | - |
HTI70_RS00315 | 53827..54114 | - | 288 | WP_001032611 | EexN family lipoprotein | - |
HTI70_RS00320 | 54127..54381 | - | 255 | WP_001043555 | EexN family lipoprotein | - |
HTI70_RS00325 | 54383..55024 | - | 642 | WP_001425343 | type IV secretion system protein | - |
HTI70_RS00330 | 55030..56025 | - | 996 | WP_001028543 | type IV secretion system protein | virB6 |
HTI70_RS00335 | 56029..56286 | - | 258 | WP_000739144 | hypothetical protein | - |
HTI70_RS00340 | 56283..56636 | - | 354 | WP_223286767 | hypothetical protein | - |
HTI70_RS00345 | 56856..57302 | - | 447 | WP_001243165 | hypothetical protein | - |
HTI70_RS00350 | 57313..57483 | - | 171 | WP_000550720 | hypothetical protein | - |
HTI70_RS00355 | 57487..57930 | - | 444 | WP_000964330 | NfeD family protein | - |
HTI70_RS00360 | 58304..59257 | - | 954 | WP_072089442 | SPFH domain-containing protein | - |
HTI70_RS00365 | 59284..59460 | - | 177 | WP_000753050 | hypothetical protein | - |
HTI70_RS00370 | 59453..59668 | - | 216 | WP_001127357 | DUF1187 family protein | - |
HTI70_RS00375 | 59661..60167 | - | 507 | WP_001326595 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
ID | 3461 | GenBank | NZ_KU934208 |
Plasmid name | pHeN867 | Incompatibility group | IncI2 |
Plasmid size | 60757 bp | Coordinate of oriT [Strand] | 13631..13683 [-] |
Host baterium | Escherichia coli strain HeN867 |
Cargo genes
Drug resistance gene | mcr-1.3 |
Virulence gene | - |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | - |