Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   103018
Name   oriT_pHeN867 in_silico
Organism   Escherichia coli strain HeN867
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_KU934208 (13631..13683 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pHeN867
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1951 GenBank   WP_015059539
Name   t4cp2_HTI70_RS00235_pHeN867 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73404.02 Da        Isoelectric Point: 9.4339

>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 32568..56025

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTI70_RS00170 28051..29175 - 1125 WP_000486716 site-specific integrase -
HTI70_RS00175 29504..29659 - 156 WP_001358489 hypothetical protein -
HTI70_RS00180 30017..30277 - 261 WP_029237379 hypothetical protein -
HTI70_RS00185 30672..31916 - 1245 WP_000750517 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTI70_RS00190 31929..32564 - 636 WP_000934977 A24 family peptidase -
HTI70_RS00195 32568..33050 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
HTI70_RS00200 33116..33673 - 558 WP_000095048 type 4 pilus major pilin -
HTI70_RS00205 33718..34827 - 1110 WP_000974903 type II secretion system F family protein -
HTI70_RS00210 34818..36356 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
HTI70_RS00215 36381..36875 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
HTI70_RS00220 36859..38181 - 1323 WP_000454142 type 4b pilus protein PilO2 -
HTI70_RS00225 38220..39863 - 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
HTI70_RS00230 39856..40392 - 537 WP_001220543 sigma 54-interacting transcriptional regulator virb4
HTI70_RS00235 40439..42397 - 1959 WP_015059539 type IV secretory system conjugative DNA transfer family protein -
HTI70_RS00240 42413..43468 - 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
HTI70_RS00245 43487..44626 - 1140 WP_000790640 TrbI/VirB10 family protein virB10
HTI70_RS00250 44616..45317 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
HTI70_RS00255 45383..46117 - 735 WP_000432282 type IV secretion system protein virB8
HTI70_RS00260 46283..48640 - 2358 WP_063078682 VirB4 family type IV secretion system protein virb4
HTI70_RS00265 48646..48966 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
HTI70_RS00400 49037..49327 - 291 WP_000865479 conjugal transfer protein -
HTI70_RS00275 49327..49911 - 585 WP_001177113 lytic transglycosylase domain-containing protein virB1
HTI70_RS00280 49932..50330 - 399 WP_001153665 hypothetical protein -
HTI70_RS00285 50449..50886 - 438 WP_000539665 type IV pilus biogenesis protein PilM -
HTI70_RS00290 50892..52127 - 1236 WP_015059538 TcpQ domain-containing protein -
HTI70_RS00295 52130..52429 - 300 WP_000835764 TrbM/KikA/MpfK family conjugal transfer protein -
HTI70_RS00300 52497..52778 - 282 WP_000638823 type II toxin-antitoxin system RelE/ParE family toxin -
HTI70_RS00305 52768..53019 - 252 WP_000121741 hypothetical protein -
HTI70_RS00310 53119..53754 - 636 WP_015059536 hypothetical protein -
HTI70_RS00315 53827..54114 - 288 WP_001032611 EexN family lipoprotein -
HTI70_RS00320 54127..54381 - 255 WP_001043555 EexN family lipoprotein -
HTI70_RS00325 54383..55024 - 642 WP_001425343 type IV secretion system protein -
HTI70_RS00330 55030..56025 - 996 WP_001028543 type IV secretion system protein virB6
HTI70_RS00335 56029..56286 - 258 WP_000739144 hypothetical protein -
HTI70_RS00340 56283..56636 - 354 WP_223286767 hypothetical protein -
HTI70_RS00345 56856..57302 - 447 WP_001243165 hypothetical protein -
HTI70_RS00350 57313..57483 - 171 WP_000550720 hypothetical protein -
HTI70_RS00355 57487..57930 - 444 WP_000964330 NfeD family protein -
HTI70_RS00360 58304..59257 - 954 WP_072089442 SPFH domain-containing protein -
HTI70_RS00365 59284..59460 - 177 WP_000753050 hypothetical protein -
HTI70_RS00370 59453..59668 - 216 WP_001127357 DUF1187 family protein -
HTI70_RS00375 59661..60167 - 507 WP_001326595 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   3461 GenBank   NZ_KU934208
Plasmid name   pHeN867 Incompatibility group   IncI2
Plasmid size   60757 bp Coordinate of oriT [Strand]   13631..13683 [-]
Host baterium   Escherichia coli strain HeN867

Cargo genes


Drug resistance gene   mcr-1.3
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -