Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   103017
Name   oriT_pBA77-MCR-1 in_silico
Organism   Escherichia coli strain BA77
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_KX013539 (15907..15959 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pBA77-MCR-1
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1950 GenBank   WP_015059539
Name   t4cp2_HTH74_RS00245_pBA77-MCR-1 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73404.02 Da        Isoelectric Point: 9.4339

>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 35087..57929

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTH74_RS00180 30309..31433 - 1125 WP_000486716 site-specific integrase -
HTH74_RS00405 31766..31984 + 219 Protein_39 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTH74_RS00190 32420..32575 + 156 WP_001358489 hypothetical protein -
HTH74_RS00195 33149..34435 - 1287 WP_104730792 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTH74_RS00200 34448..35083 - 636 WP_000934977 A24 family peptidase -
HTH74_RS00205 35087..35569 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
HTH74_RS00210 35635..36198 - 564 WP_034169414 type 4 pilus major pilin -
HTH74_RS00215 36248..37357 - 1110 WP_000974903 type II secretion system F family protein -
HTH74_RS00220 37348..38886 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
HTH74_RS00225 38911..39405 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
HTH74_RS00230 39389..40711 - 1323 WP_000454142 type 4b pilus protein PilO2 -
HTH74_RS00235 40750..42393 - 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
HTH74_RS00240 42386..42934 - 549 WP_172687990 sigma 54-interacting transcriptional regulator virb4
HTH74_RS00245 42981..44939 - 1959 WP_015059539 type IV secretory system conjugative DNA transfer family protein -
HTH74_RS00250 44955..46010 - 1056 WP_001542006 P-type DNA transfer ATPase VirB11 virB11
HTH74_RS00255 46029..47168 - 1140 WP_034169415 TrbI/VirB10 family protein virB10
HTH74_RS00260 47158..47859 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
HTH74_RS00265 47925..48659 - 735 WP_000432282 type IV secretion system protein virB8
HTH74_RS00270 48825..51182 - 2358 WP_000548950 VirB4 family type IV secretion system protein virb4
HTH74_RS00275 51188..51508 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
HTH74_RS00400 51579..51869 - 291 WP_000865479 conjugal transfer protein -
HTH74_RS00285 51869..52453 - 585 WP_001177117 lytic transglycosylase domain-containing protein virB1
HTH74_RS00290 52474..52872 - 399 WP_001153669 hypothetical protein -
HTH74_RS00295 52991..53428 - 438 WP_034169416 type IV pilus biogenesis protein PilM -
HTH74_RS00300 53434..54669 - 1236 WP_034169417 toxin co-regulated pilus biosynthesis Q family protein -
HTH74_RS00305 54672..54971 - 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
HTH74_RS00310 55019..55828 + 810 WP_024237698 DUF5710 domain-containing protein -
HTH74_RS00315 56051..56275 - 225 WP_000713562 EexN family lipoprotein -
HTH74_RS00320 56284..56928 - 645 WP_001310442 type IV secretion system protein -
HTH74_RS00325 56934..57929 - 996 WP_001028540 type IV secretion system protein virB6
HTH74_RS00330 57933..58190 - 258 WP_000739144 hypothetical protein -
HTH74_RS00335 58187..58540 - 354 WP_223286767 hypothetical protein -
HTH74_RS00340 58760..59206 - 447 WP_001243165 hypothetical protein -
HTH74_RS00345 59217..59387 - 171 WP_000550720 hypothetical protein -
HTH74_RS00350 59391..59834 - 444 WP_000964330 NfeD family protein -
HTH74_RS00355 60208..61161 - 954 WP_072089442 SPFH domain-containing protein -
HTH74_RS00360 61188..61364 - 177 WP_000753050 hypothetical protein -
HTH74_RS00365 61357..61572 - 216 WP_001127357 DUF1187 family protein -
HTH74_RS00370 61565..62071 - 507 WP_001326595 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   3460 GenBank   NZ_KX013539
Plasmid name   pBA77-MCR-1 Incompatibility group   IncI2
Plasmid size   62661 bp Coordinate of oriT [Strand]   15907..15959 [-]
Host baterium   Escherichia coli strain BA77

Cargo genes


Drug resistance gene   mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -