Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102943
Name   oriT_FWSEC0141|unnamed4 in_silico
Organism   Escherichia coli strain FWSEC0141
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_RRHG01000214 (1265..1324 [+], 60 nt)
oriT length   60 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 60 nt

>oriT_FWSEC0141|unnamed4
GGGTGTCGGGGCGCAGCCATGACCCAGTCACATAGCGATAGCGGAGTGTATACTGGCTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2208 GenBank   WP_169187798
Name   Relaxase_C9Z91_RS28650_FWSEC0141|unnamed4 insolico UniProt ID   _
Length   201 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 201 a.a.        Molecular weight: 22553.58 Da        Isoelectric Point: 9.5301

>WP_169187798.1 relaxase/mobilization nuclease domain-containing protein, partial [Escherichia coli]
MIVKFHARGKGGGSGPVDYLLGRERSREGARVLRGAPEEVRELIDATPFAKKYTSGVLSFAEQTLPPGER
ERVMESFERVLMPGLEKNQYSILWVEHQDKGRLELNFVIPNMELASGKRLQPYYDRADRPRINAWQTLVN
HHYGLHDPNAPENRRTLVTPNNLPKAKQEAAEAITRGVEALYHAGALKTRQDVTEALTAAG

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(58-201)


  Protein structure



No available structure.




Auxiliary protein

ID   909 GenBank   WP_001444404
Name   WP_001444404_FWSEC0141|unnamed4 insolico UniProt ID   _
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11855.62 Da        Isoelectric Point: 10.1917

>WP_001444404.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Bacteria]
MLTIRVTDEEHARLLARCEGKQLASWMRKVCLGAPPSKTSGLPTLAPPLLRQFASVGNNLNQIARKINSG
QWSGHDRVHVVAALMAIGRELSELRDEVRKQGERDDS

  Protein domains


Predicted by InterproScan.

Bacterial mobilisation protein (MobC) (MobC)

(50-94)


  Protein structure



No available structure.




Host bacterium

ID   3386 GenBank   NZ_RRHG01000214
Plasmid name   FWSEC0141|unnamed4 Incompatibility group   ColRNAI
Plasmid size   6751 bp Coordinate of oriT [Strand]   1265..1324 [+]
Host baterium   Escherichia coli strain FWSEC0141

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -