Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   102942
Name   oriT_p13C1065T-5 in_silico
Organism   Escherichia coli strain 13C1065T
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP019264 (28276..28328 [+], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_p13C1065T-5
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1888 GenBank   WP_000338974
Name   t4cp2_BWI86_RS27985_p13C1065T-5 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73347.89 Da        Isoelectric Point: 9.1391

>WP_000338974.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 49871..73416

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BWI86_RS27850 (BWI86_27885) 45895..46347 + 453 WP_000101553 CaiF/GrlA family transcriptional regulator -
BWI86_RS27855 (BWI86_27890) 46340..46534 + 195 WP_000049865 DUF1187 family protein -
BWI86_RS27860 (BWI86_27895) 46580..47533 + 954 WP_072105959 SPFH domain-containing protein -
BWI86_RS27865 (BWI86_27900) 47606..48049 + 444 WP_000964840 NfeD family protein -
BWI86_RS29295 48053..48223 + 171 WP_000550721 hypothetical protein -
BWI86_RS27870 (BWI86_27905) 48234..48896 + 663 WP_001419740 hypothetical protein -
BWI86_RS27880 (BWI86_27915) 49080..49295 + 216 WP_001360344 hypothetical protein -
BWI86_RS27885 (BWI86_27920) 49311..49613 + 303 WP_001360345 hypothetical protein -
BWI86_RS27890 (BWI86_27925) 49610..49867 + 258 WP_000739144 hypothetical protein -
BWI86_RS27895 (BWI86_27930) 49871..50857 + 987 WP_001419739 type IV secretion system protein virB6
BWI86_RS27900 (BWI86_27935) 50863..51510 + 648 WP_001419738 type IV secretion system protein -
BWI86_RS27905 (BWI86_27940) 51514..51750 + 237 WP_000750964 EexN family lipoprotein -
BWI86_RS27910 (BWI86_27945) 51797..52606 - 810 WP_001419737 DUF5710 domain-containing protein -
BWI86_RS27915 (BWI86_27950) 52654..53286 + 633 WP_001419736 hypothetical protein -
BWI86_RS27920 (BWI86_27955) 53353..53652 + 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
BWI86_RS27925 (BWI86_27960) 53655..54890 + 1236 WP_001419735 TcpQ domain-containing protein -
BWI86_RS27930 (BWI86_27965) 54896..55333 + 438 WP_015387358 type IV pilus biogenesis protein PilM -
BWI86_RS27935 (BWI86_27970) 55673..56071 + 399 WP_001708012 hypothetical protein -
BWI86_RS27940 (BWI86_27975) 56092..56676 + 585 WP_001401693 lytic transglycosylase domain-containing protein virB1
BWI86_RS29785 56676..56966 + 291 WP_000865479 conjugal transfer protein -
BWI86_RS27950 (BWI86_27985) 57037..57357 + 321 WP_000362081 VirB3 family type IV secretion system protein virB3
BWI86_RS27955 (BWI86_27990) 57363..59720 + 2358 WP_148116478 VirB4 family type IV secretion system protein virb4
BWI86_RS27965 (BWI86_28000) 59884..60618 + 735 WP_000432282 type IV secretion system protein virB8
BWI86_RS27970 (BWI86_28005) 60684..61385 + 702 WP_053882504 TrbG/VirB9 family P-type conjugative transfer protein -
BWI86_RS27975 (BWI86_28010) 61375..62514 + 1140 WP_015387354 TrbI/VirB10 family protein virB10
BWI86_RS27980 (BWI86_28015) 62533..63588 + 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
BWI86_RS27985 (BWI86_28020) 63604..65562 + 1959 WP_000338974 type IV secretory system conjugative DNA transfer family protein -
BWI86_RS27990 (BWI86_28025) 65609..66127 + 519 WP_015387353 YfdA protein virb4
BWI86_RS27995 (BWI86_28030) 66120..67763 + 1644 WP_001035588 PilN family type IVB pilus formation outer membrane protein -
BWI86_RS28000 (BWI86_28035) 67814..69124 + 1311 WP_001454111 type 4b pilus protein PilO2 -
BWI86_RS28005 (BWI86_28040) 69108..69602 + 495 WP_000912553 type IV pilus biogenesis protein PilP -
BWI86_RS28010 (BWI86_28045) 69627..71165 + 1539 WP_000466227 ATPase, T2SS/T4P/T4SS family virB11
BWI86_RS28015 (BWI86_28050) 71156..72265 + 1110 WP_000974902 type II secretion system F family protein -
BWI86_RS28020 (BWI86_28055) 72310..72867 + 558 WP_000095049 type 4 pilus major pilin -
BWI86_RS28025 (BWI86_28060) 72934..73416 + 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
BWI86_RS28030 (BWI86_28065) 73420..74055 + 636 WP_000934978 A24 family peptidase -
BWI86_RS28035 (BWI86_28070) 74068..75384 + 1317 WP_074526577 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
BWI86_RS28040 (BWI86_28075) 75363..75716 - 354 WP_157909760 pilus assembly protein -
BWI86_RS28050 (BWI86_28090) 76293..76448 + 156 WP_001358489 hypothetical protein -
BWI86_RS30175 (BWI86_28105) 77069..77290 - 222 Protein_93 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -


Host bacterium


ID   3385 GenBank   NZ_CP019264
Plasmid name   p13C1065T-5 Incompatibility group   IncI2
Plasmid size   82265 bp Coordinate of oriT [Strand]   28276..28328 [+]
Host baterium   Escherichia coli strain 13C1065T

Cargo genes


Drug resistance gene   mcr-1.1, blaCTX-M-55
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -