Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   102934
Name   oriT1_p13P477T-4 in_silico
Organism   Escherichia coli strain 13P477T
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP019277 ( 6051..6103 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT1_p13P477T-4
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1882 GenBank   WP_000338976
Name   t4cp2_BWI89_RS27595_p13P477T-4 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73346.95 Da        Isoelectric Point: 9.3476

>WP_000338976.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.



ID   1883 GenBank   WP_236919631
Name   t4cp2_BWI89_RS27995_p13P477T-4 insolico UniProt ID   _
Length   522 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 522 a.a.        Molecular weight: 58860.52 Da        Isoelectric Point: 8.2960

>WP_236919631.1 type IV secretory system conjugative DNA transfer family protein [Escherichia coli]
MFKGRYKKQFIYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKC
FLFAPAGYAETIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLG
LYLLDKERFHLEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSA
PDRTRGSIETNFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVN
ENCRELPEHNPDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTT
FTENSAVVLYYPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSL
RDKKNKARNIAIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIY
LPKAGGKKVMVAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(6-461)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 26969..49793

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BWI89_RS27520 (BWI89_27500) 22011..23543 - 1533 WP_000998025 IS66-like element ISEc8 family transposase -
BWI89_RS27525 (BWI89_27505) 23593..23940 - 348 WP_000612591 IS66 family insertion sequence element accessory protein TnpB -
BWI89_RS27530 (BWI89_27510) 23937..24317 - 381 WP_001171554 transposase -
BWI89_RS29445 (BWI89_27515) 24439..24699 - 261 WP_198965019 pilus assembly protein -
BWI89_RS27545 (BWI89_27525) 25076..26317 - 1242 Protein_28 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
BWI89_RS27550 (BWI89_27530) 26330..26965 - 636 WP_000934979 A24 family peptidase -
BWI89_RS27555 (BWI89_27535) 26969..27451 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
BWI89_RS27560 (BWI89_27540) 27517..28074 - 558 WP_000095048 type 4 pilus major pilin -
BWI89_RS27565 (BWI89_27545) 28119..29228 - 1110 WP_000974903 type II secretion system F family protein -
BWI89_RS27570 (BWI89_27550) 29219..30757 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
BWI89_RS27575 (BWI89_27555) 30782..31276 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
BWI89_RS27580 (BWI89_27560) 31260..32570 - 1311 WP_001454111 type 4b pilus protein PilO2 -
BWI89_RS27585 (BWI89_27565) 32621..34264 - 1644 WP_001035589 PilN family type IVB pilus formation outer membrane protein -
BWI89_RS27590 (BWI89_27570) 34257..34799 - 543 WP_001220544 sigma 54-interacting transcriptional regulator virb4
BWI89_RS27595 (BWI89_27575) 34846..36804 - 1959 WP_000338976 type IV secretory system conjugative DNA transfer family protein -
BWI89_RS27600 (BWI89_27580) 36820..37875 - 1056 WP_001542006 P-type DNA transfer ATPase VirB11 virB11
BWI89_RS27605 (BWI89_27585) 37894..39033 - 1140 WP_001542008 TrbI/VirB10 family protein virB10
BWI89_RS27610 (BWI89_27590) 39023..39724 - 702 WP_049824867 TrbG/VirB9 family P-type conjugative transfer protein -
BWI89_RS27615 (BWI89_27595) 39790..40524 - 735 WP_000432282 type IV secretion system protein virB8
BWI89_RS27625 (BWI89_27605) 40690..43047 - 2358 WP_000548950 VirB4 family type IV secretion system protein virb4
BWI89_RS27630 (BWI89_27610) 43053..43373 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
BWI89_RS30245 43444..43734 - 291 WP_000865479 conjugal transfer protein -
BWI89_RS27640 (BWI89_27620) 43734..44318 - 585 WP_065358197 lytic transglycosylase domain-containing protein virB1
BWI89_RS27645 (BWI89_27625) 44339..44737 - 399 WP_001153669 hypothetical protein -
BWI89_RS27650 (BWI89_27630) 44856..45293 - 438 WP_034169416 type IV pilus biogenesis protein PilM -
BWI89_RS27655 (BWI89_27635) 45299..46534 - 1236 WP_053899060 toxin co-regulated pilus biosynthesis Q family protein -
BWI89_RS27660 (BWI89_27640) 46537..46836 - 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
BWI89_RS30590 (BWI89_27645) 46884..47692 + 809 Protein_51 DUF5710 domain-containing protein -
BWI89_RS27670 (BWI89_27650) 47915..48139 - 225 WP_000713562 EexN family lipoprotein -
BWI89_RS27675 (BWI89_27655) 48148..48792 - 645 WP_001310442 type IV secretion system protein -
BWI89_RS27680 (BWI89_27660) 48798..49793 - 996 WP_001028540 type IV secretion system protein virB6
BWI89_RS27685 (BWI89_27665) 49797..50054 - 258 WP_000739144 hypothetical protein -
BWI89_RS27690 (BWI89_27670) 50051..50353 - 303 WP_001360345 hypothetical protein -
BWI89_RS27695 (BWI89_27675) 50334..50591 - 258 WP_001542015 hypothetical protein -
BWI89_RS27700 (BWI89_27680) 50624..51070 - 447 WP_001243165 hypothetical protein -
BWI89_RS29740 51081..51251 - 171 WP_000550720 hypothetical protein -
BWI89_RS27705 (BWI89_27685) 51255..51698 - 444 WP_000964330 NfeD family protein -
BWI89_RS27715 (BWI89_27695) 52072..53025 - 954 WP_072089442 SPFH domain-containing protein -
BWI89_RS29745 53052..53228 - 177 WP_000753050 hypothetical protein -
BWI89_RS27720 (BWI89_27700) 53221..53436 - 216 WP_001127357 DUF1187 family protein -
BWI89_RS27725 (BWI89_27705) 53429..53881 - 453 WP_000101552 CaiF/GrlA family transcriptional regulator -

Region 2: 89999..103557

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BWI89_RS29460 (BWI89_27910) 85348..85608 + 261 WP_198965019 pilus assembly protein -
BWI89_RS27930 (BWI89_27915) 85730..86110 + 381 WP_001171554 transposase -
BWI89_RS27935 (BWI89_27920) 86107..86454 + 348 WP_000612591 IS66 family insertion sequence element accessory protein TnpB -
BWI89_RS27940 (BWI89_27925) 86504..88036 + 1533 WP_000998025 IS66-like element ISEc8 family transposase -
BWI89_RS27945 (BWI89_27930) 88070..89347 - 1278 WP_148119647 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
BWI89_RS27950 (BWI89_27935) 89360..89995 - 636 WP_000934979 A24 family peptidase -
BWI89_RS27955 (BWI89_27940) 89999..90481 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
BWI89_RS27960 (BWI89_27945) 90547..91104 - 558 WP_000095048 type 4 pilus major pilin -
BWI89_RS27965 (BWI89_27950) 91149..92258 - 1110 WP_000974903 type II secretion system F family protein -
BWI89_RS27970 (BWI89_27955) 92249..93787 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
BWI89_RS27975 (BWI89_27960) 93812..94306 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
BWI89_RS27980 (BWI89_27965) 94290..95600 - 1311 WP_001454111 type 4b pilus protein PilO2 -
BWI89_RS27985 (BWI89_27970) 95651..97294 - 1644 WP_001035589 PilN family type IVB pilus formation outer membrane protein -
BWI89_RS27990 (BWI89_27975) 97287..97829 - 543 WP_001220544 sigma 54-interacting transcriptional regulator virb4
BWI89_RS27995 (BWI89_27980) 97876..99835 - 1960 Protein_117 type IV secretory system conjugative DNA transfer family protein -
BWI89_RS28000 (BWI89_27985) 99851..100907 - 1057 Protein_118 P-type DNA transfer ATPase VirB11 -
BWI89_RS30280 100926..101162 - 237 WP_236919633 TrbI/VirB10 family protein -
BWI89_RS30285 101132..101593 - 462 WP_236919634 TrbI/VirB10 family protein virB10
BWI89_RS30290 101605..102063 - 459 WP_236919635 hypothetical protein -
BWI89_RS30380 102053..102301 - 249 WP_020246051 TrbG/VirB9 family P-type conjugative transfer protein virB9
BWI89_RS30385 102298..102615 - 318 WP_335589284 TrbG/VirB9 family P-type conjugative transfer protein -
BWI89_RS28015 (BWI89_28000) 102883..103557 - 675 WP_236919636 type IV secretion system protein virB8
BWI89_RS28025 (BWI89_27380) 103723..105414 - 1692 Protein_125 conjugal transfer protein -


Host bacterium


ID   3377 GenBank   NZ_CP019277
Plasmid name   p13P477T-4 Incompatibility group   IncI2
Plasmid size   105415 bp Coordinate of oriT [Strand]   69067..69119 [-]; 6051..6103 [-]
Host baterium   Escherichia coli strain 13P477T

Cargo genes


Drug resistance gene   mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -