Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102933
Name   oriT1_p13P477T-3 in_silico
Organism   Escherichia coli strain 13P477T
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP019276 ( 2466..2589 [-], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      101..106, 119..124  (TTTAAT..ATTAAA)
 91..99, 113..121  (AATAATGTA..TACATTATT)
 90..95, 107..112  (AAATAA..TTATTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT1_p13P477T-3
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGCTTTTTGAATCATTAGCTTATGTTTTAAATAATGTATTTTAATTTATTTTACATTATTAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   904 GenBank   WP_001254386
Name   WP_001254386_p13P477T-3 insolico UniProt ID   A0A3Z6KJB5
Length   75 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 75 a.a.        Molecular weight: 9005.11 Da        Isoelectric Point: 10.1422

>WP_001254386.1 MULTISPECIES: conjugal transfer relaxosome protein TraY [Gammaproteobacteria]
MRRRNARGGISRTVSVYLDEDTNNRLIKAKDRSGRSKTIEVQIRLRDHLKRFPDFYNEEIFREVTEESES
TFKEL

  Protein domains


Predicted by InterproScan.

TraY domain (TraY)

(14-61)


  Protein structure


Source ID Structure
AlphaFold DB A0A3Z6KJB5

ID   904 GenBank   WP_001254386
Name   WP_001254386_p13P477T-3 insolico UniProt ID   A0A3Z6KJB5
Length   75 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 75 a.a.        Molecular weight: 9005.11 Da        Isoelectric Point: 10.1422

>WP_001254386.1 MULTISPECIES: conjugal transfer relaxosome protein TraY [Gammaproteobacteria]
MRRRNARGGISRTVSVYLDEDTNNRLIKAKDRSGRSKTIEVQIRLRDHLKRFPDFYNEEIFREVTEESES
TFKEL

  Protein domains


Predicted by InterproScan.

TraY domain (TraY)

(14-61)


  Protein structure


Source ID Structure
AlphaFold DB A0A3Z6KJB5

ID   906 GenBank   WP_000124981
Name   WP_000124981_p13P477T-3 insolico UniProt ID   A0A630FTW9
Length   127 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 127 a.a.        Molecular weight: 14542.59 Da        Isoelectric Point: 5.0278

>WP_000124981.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Gammaproteobacteria]
MARVNLYISNEVHEKINMIVEKRRQEGARDKDISLSGTASMLLELGLRVYDAQMERKESAFNQTEFNKLL
LECVVKTQSTVAKILGIESLSPHVSGNPKFEYASMVDDIREKVSVEMDRFFPKNDDE

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-126)


  Protein structure


Source ID Structure
AlphaFold DB A0A630FTW9


T4CP

ID   1880 GenBank   WP_011402783
Name   traD_BWI89_RS27050_p13P477T-3 insolico UniProt ID   _
Length   732 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 732 a.a.        Molecular weight: 83199.81 Da        Isoelectric Point: 5.0504

>WP_011402783.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGESFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQARPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQPQQPQQ
PQQPQQPQQPVSPAINDKKSDSGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYEAWQQEN
HPDIQQQMQRREEVNINVHRERGEDVEPGDDF

  Protein domains


Predicted by InterproScan.

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(173-560)

F sex factor protein N terminal (TraD_N)

(32-128)

  Protein structure



No available structure.



ID   1881 GenBank   WP_015059012
Name   traC_BWI89_RS27180_p13P477T-3 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99393.22 Da        Isoelectric Point: 6.3465

>WP_015059012.1 MULTISPECIES: type IV secretion system protein TraC [Gammaproteobacteria]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGVPFCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMNAAA
TQFPLPEGMNLPLTLRHYRVFFSYCSPSKKKSRADILEMENLVKIIRASLQGASITTQAVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNMADNYSNLLNPEMSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFKGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKKKQARIDDVVDFLKNARDNDQYVESPTIRSRLDEMIVLLDQYT
ANGTYGRYFNSDEPSLRDDARMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNRKVGEFIQKGYRTCRRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

Family of unknown function (DUF5934) (DUF5934)

(290-446)

TraG P-loop domain (P-loop_TraG)

(467-771)

TraC protein (TraC_F_IV)

(38-276)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 45583..76451

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BWI89_RS27050 (BWI89_27030) 45583..47781 - 2199 WP_011402783 type IV conjugative transfer system coupling protein TraD virb4
BWI89_RS27055 (BWI89_27035) 47832..48569 - 738 WP_015059020 hypothetical protein -
BWI89_RS27060 48772..49503 - 732 WP_021559024 conjugal transfer complement resistance protein TraT -
BWI89_RS27065 49528..50049 - 522 WP_000632668 conjugal transfer entry exclusion protein TraS -
BWI89_RS27070 (BWI89_27045) 50082..52899 - 2818 Protein_66 conjugal transfer mating-pair stabilization protein TraG -
BWI89_RS27075 (BWI89_27050) 52896..54269 - 1374 WP_000944325 conjugal transfer pilus assembly protein TraH traH
BWI89_RS27080 (BWI89_27055) 54256..54648 - 393 WP_000126338 F-type conjugal transfer protein TrbF -
BWI89_RS29705 (BWI89_27060) 54602..54799 - 198 Protein_69 conjugal transfer protein TrbB -
BWI89_RS27090 (BWI89_27065) 54830..56401 - 1572 WP_000381395 IS66-like element ISCro1 family transposase -
BWI89_RS27095 (BWI89_27070) 56421..56768 - 348 WP_000624622 IS66 family insertion sequence element accessory protein TnpB -
BWI89_RS27100 (BWI89_27075) 56768..57445 - 678 WP_148119637 IS66-like element accessory protein TnpA -
BWI89_RS29400 57498..57623 - 126 Protein_73 conjugal transfer protein TrbJ -
BWI89_RS27115 (BWI89_27090) 57613..58158 - 546 WP_000059817 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
BWI89_RS27120 (BWI89_27095) 58145..58381 - 237 WP_000270010 type-F conjugative transfer system pilin chaperone TraQ -
BWI89_RS27125 (BWI89_27100) 58542..59285 - 744 WP_015059017 type-F conjugative transfer system pilin assembly protein TraF traF
BWI89_RS27130 (BWI89_27105) 59278..59535 - 258 WP_053913405 conjugal transfer protein TrbE -
BWI89_RS27135 (BWI89_27110) 59562..61412 - 1851 WP_015059015 type-F conjugative transfer system mating-pair stabilization protein TraN traN
BWI89_RS27140 (BWI89_27115) 61409..61831 - 423 WP_001229309 HNH endonuclease signature motif containing protein -
BWI89_RS27145 (BWI89_27120) 61857..62228 - 372 WP_000056336 hypothetical protein -
BWI89_RS27150 (BWI89_27125) 62225..62863 - 639 WP_000087532 type-F conjugative transfer system pilin assembly protein TrbC trbC
BWI89_RS27155 (BWI89_27130) 62890..63411 - 522 WP_015059014 hypothetical protein -
BWI89_RS27160 (BWI89_27135) 63474..63782 - 309 WP_000412447 hypothetical protein -
BWI89_RS27165 (BWI89_27140) 63809..64801 - 993 WP_000830838 conjugal transfer pilus assembly protein TraU traU
BWI89_RS27170 (BWI89_27145) 64798..65430 - 633 WP_001203735 type-F conjugative transfer system protein TraW traW
BWI89_RS27175 (BWI89_27150) 65427..65813 - 387 WP_015059013 type-F conjugative transfer system protein TrbI -
BWI89_RS27180 (BWI89_27155) 65810..68437 - 2628 WP_015059012 type IV secretion system protein TraC virb4
BWI89_RS27185 (BWI89_27160) 68597..68818 - 222 WP_001278692 conjugal transfer protein TraR -
BWI89_RS27190 (BWI89_27165) 68953..69468 - 516 WP_000809902 type IV conjugative transfer system lipoprotein TraV traV
BWI89_RS27195 (BWI89_27170) 69465..69716 - 252 WP_001038341 conjugal transfer protein TrbG -
BWI89_RS27200 (BWI89_27175) 69728..69925 - 198 WP_001324648 conjugal transfer protein TrbD -
BWI89_RS27205 (BWI89_27180) 69912..70502 - 591 WP_000002778 conjugal transfer pilus-stabilizing protein TraP -
BWI89_RS27210 (BWI89_27185) 70492..71919 - 1428 WP_032297072 F-type conjugal transfer pilus assembly protein TraB traB
BWI89_RS27215 (BWI89_27190) 71919..72647 - 729 WP_236919630 type-F conjugative transfer system secretin TraK traK
BWI89_RS27220 (BWI89_27195) 72634..73200 - 567 WP_000399794 type IV conjugative transfer system protein TraE traE
BWI89_RS27225 (BWI89_27200) 73222..73533 - 312 WP_000012106 type IV conjugative transfer system protein TraL traL
BWI89_RS27230 (BWI89_27205) 73548..73913 - 366 WP_021519752 type IV conjugative transfer system pilin TraA -
BWI89_RS27235 (BWI89_27210) 73947..74174 - 228 WP_001254386 conjugal transfer relaxosome protein TraY -
BWI89_RS27240 (BWI89_27215) 74268..74953 - 686 Protein_99 PAS domain-containing protein -
BWI89_RS27245 (BWI89_27220) 75144..75527 - 384 WP_000124981 conjugal transfer relaxosome DNA-binding protein TraM -
BWI89_RS27250 (BWI89_27225) 75804..76451 + 648 WP_015059008 transglycosylase SLT domain-containing protein virB1
BWI89_RS27255 (BWI89_27230) 76748..77569 - 822 WP_001234445 DUF932 domain-containing protein -
BWI89_RS27260 (BWI89_27235) 77683..77973 - 291 WP_148119640 hypothetical protein -
BWI89_RS29710 (BWI89_27245) 78272..78568 + 297 Protein_104 hypothetical protein -
BWI89_RS30210 (BWI89_27255) 78888..79009 - 122 Protein_105 Hok/Gef family protein -
BWI89_RS27290 (BWI89_27260) 79255..80040 - 786 Protein_106 plasmid SOS inhibition protein A -
BWI89_RS27295 (BWI89_27265) 80037..80471 - 435 WP_000845922 conjugation system SOS inhibitor PsiB -

Host bacterium

ID   3376 GenBank   NZ_CP019276
Plasmid name   p13P477T-3 Incompatibility group   IncFII
Plasmid size   91701 bp Coordinate of oriT [Strand]   75756..75879 [-]; 2466..2589 [-]
Host baterium   Escherichia coli strain 13P477T

Cargo genes

Drug resistance gene   blaCTX-M-55, blaTEM-1B, fosA3
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -