Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   102922
Name   oriT_p1540-1 in_silico
Organism   Escherichia coli strain CRE1540
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP019052 (18937..18989 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_p1540-1
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1869 GenBank   WP_015059539
Name   t4cp2_BVL39_RS25820_p1540-1 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73404.02 Da        Isoelectric Point: 9.4339

>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 37344..60801

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BVL39_RS25755 (BVL39_26085) 32674..33327 - 654 WP_170852113 hypothetical protein -
BVL39_RS25760 (BVL39_26090) 33339..34463 - 1125 WP_000486716 site-specific integrase -
BVL39_RS29035 35091..35426 + 336 WP_158638052 hypothetical protein -
BVL39_RS25770 (BVL39_26100) 35436..36692 - 1257 WP_236918904 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
BVL39_RS25775 (BVL39_26105) 36705..37340 - 636 WP_000934977 A24 family peptidase -
BVL39_RS25780 (BVL39_26110) 37344..37826 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
BVL39_RS25785 (BVL39_26115) 37892..38449 - 558 WP_000095048 type 4 pilus major pilin -
BVL39_RS25790 (BVL39_26120) 38494..39603 - 1110 WP_000974903 type II secretion system F family protein -
BVL39_RS25795 (BVL39_26125) 39594..41132 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
BVL39_RS25800 (BVL39_26130) 41157..41651 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
BVL39_RS25805 (BVL39_26135) 41635..42945 - 1311 WP_001454111 type 4b pilus protein PilO2 -
BVL39_RS25810 (BVL39_26140) 42996..44639 - 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
BVL39_RS25815 (BVL39_26145) 44632..45168 - 537 WP_001220543 sigma 54-interacting transcriptional regulator virb4
BVL39_RS25820 (BVL39_26150) 45215..47173 - 1959 WP_015059539 type IV secretory system conjugative DNA transfer family protein -
BVL39_RS25825 (BVL39_26155) 47189..48244 - 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
BVL39_RS25830 (BVL39_26160) 48263..49402 - 1140 WP_000790640 TrbI/VirB10 family protein virB10
BVL39_RS25835 (BVL39_26165) 49392..50093 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
BVL39_RS25840 (BVL39_26170) 50159..50893 - 735 WP_000432282 type IV secretion system protein virB8
BVL39_RS25850 (BVL39_26180) 51059..53416 - 2358 WP_063078682 VirB4 family type IV secretion system protein virb4
BVL39_RS25855 (BVL39_26185) 53422..53742 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
BVL39_RS29720 (BVL39_26190) 53813..54103 - 291 WP_000865479 conjugal transfer protein -
BVL39_RS25865 (BVL39_26195) 54103..54687 - 585 WP_001177113 lytic transglycosylase domain-containing protein virB1
BVL39_RS25870 (BVL39_26200) 54708..55106 - 399 WP_072643816 hypothetical protein -
BVL39_RS25875 (BVL39_26205) 55225..55662 - 438 WP_000539665 type IV pilus biogenesis protein PilM -
BVL39_RS25880 (BVL39_26210) 55668..56903 - 1236 WP_015059538 TcpQ domain-containing protein -
BVL39_RS25885 (BVL39_26215) 56906..57205 - 300 WP_000835764 TrbM/KikA/MpfK family conjugal transfer protein -
BVL39_RS25890 (BVL39_26220) 57273..57554 - 282 WP_000638823 type II toxin-antitoxin system RelE/ParE family toxin -
BVL39_RS25895 (BVL39_26225) 57544..57795 - 252 WP_000121741 hypothetical protein -
BVL39_RS25900 (BVL39_26230) 57895..58530 - 636 WP_015059536 hypothetical protein -
BVL39_RS25905 (BVL39_26235) 58603..58890 - 288 WP_001032611 EexN family lipoprotein -
BVL39_RS25910 (BVL39_26240) 58903..59157 - 255 WP_001043555 EexN family lipoprotein -
BVL39_RS25915 (BVL39_26245) 59159..59800 - 642 WP_001425343 type IV secretion system protein -
BVL39_RS25920 (BVL39_26250) 59806..60801 - 996 WP_001028543 type IV secretion system protein virB6
BVL39_RS25925 (BVL39_26255) 60805..61062 - 258 WP_000739144 hypothetical protein -
BVL39_RS25930 (BVL39_26260) 61059..61361 - 303 WP_001360345 hypothetical protein -
BVL39_RS25935 (BVL39_26265) 61342..61599 - 258 WP_001542015 hypothetical protein -
BVL39_RS25940 (BVL39_26270) 61632..62078 - 447 WP_001243165 hypothetical protein -
BVL39_RS29290 62089..62259 - 171 WP_000550720 hypothetical protein -
BVL39_RS25945 (BVL39_26275) 62263..62706 - 444 WP_000964330 NfeD family protein -
BVL39_RS25955 (BVL39_26285) 63080..64033 - 954 WP_072089442 SPFH domain-containing protein -
BVL39_RS29295 64060..64236 - 177 WP_000753050 hypothetical protein -
BVL39_RS25960 (BVL39_26290) 64229..64444 - 216 WP_001127357 DUF1187 family protein -
BVL39_RS25965 (BVL39_26295) 64437..64889 - 453 WP_000101552 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   3365 GenBank   NZ_CP019052
Plasmid name   p1540-1 Incompatibility group   IncI2
Plasmid size   65533 bp Coordinate of oriT [Strand]   18937..18989 [-]
Host baterium   Escherichia coli strain CRE1540

Cargo genes


Drug resistance gene   blaCTX-M-55, mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -