Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102901
Name   oriT_FWSEC0322|unnamed2 in_silico
Organism   Escherichia coli strain FWSEC0322
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_RRKZ01000082 (54290..54375 [+], 86 nt)
oriT length   86 nt
IRs (inverted repeats)      61..68, 73..80  (TTGGTGGT..ACCACCAA)
 27..34, 37..44  (GCAAAAAC..GTTTTTGC)
Location of nic site      53..54
Conserved sequence flanking the
  nic site    		  GGTGTGGTGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 86 nt

>oriT_FWSEC0322|unnamed2
AACTACTTATTTGCAAAGAAAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   888 GenBank   WP_249528313
Name   WP_249528313_FWSEC0322|unnamed2 insolico UniProt ID   _
Length   126 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 126 a.a.        Molecular weight: 14741.00 Da        Isoelectric Point: 10.2984

>WP_249528313.1 conjugal transfer relaxosome DNA-bindin protein TraY [Escherichia coli]
MFLKRFGTRSATGKMVKLKLPVDVESLLIEASERSGRSRSFEAVIRLKDHLHRYPKFNRISNVYGKSLVK
YLTMRLDDETNKLLIAAKNRSGWCKTDEAADRVIDHLIKFPDFYNSEIYREATEQR

  Protein domains


Predicted by InterproScan.

TraY domain (TraY)

(72-118)

TraY domain (TraY)

(17-58)


  Protein structure



No available structure.



ID   889 GenBank   WP_032210979
Name   WP_032210979_FWSEC0322|unnamed2 insolico UniProt ID   A0A234XLE3
Length   127 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 127 a.a.        Molecular weight: 14456.48 Da        Isoelectric Point: 5.0286

>WP_032210979.1 conjugal transfer relaxosome DNA-binding protein TraM [Escherichia coli]
MAKIQVYVNDHVSEKINAIAVQRRAEGAKEKDVSYSSIASMLLELGLRVYEAQMERKETAFNQTEFNKVL
LECVVKTQSSVAKILGIESLSPHVAGNPKFEYANMVEDIRDKVSVEMERFFPRNDEE

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-126)


  Protein structure


Source ID Structure
AlphaFold DB A0A234XLE3


T4CP

ID   1851 GenBank   WP_136719386
Name   traD_C9098_RS24655_FWSEC0322|unnamed2 insolico UniProt ID   _
Length   729 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 729 a.a.        Molecular weight: 82909.60 Da        Isoelectric Point: 5.1107

>WP_136719386.1 type IV conjugative transfer system coupling protein TraD [Escherichia coli]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWMLVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIRSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLASVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
KRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGESFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQARPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQPQQPQQ
PQQPQQPVSPAINDKKSDAGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAVYEAWQREQNPD
IQQQMQRREEVNINVHRERGEDVEPGDDF

  Protein domains


Predicted by InterproScan.

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(173-560)

F sex factor protein N terminal (TraD_N)

(32-128)

  Protein structure



No available structure.



ID   1852 GenBank   WP_136719388
Name   traC_C9098_RS24765_FWSEC0322|unnamed2 insolico UniProt ID   _
Length   876 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 876 a.a.        Molecular weight: 99502.21 Da        Isoelectric Point: 5.6231

>WP_136719388.1 type IV secretion system protein TraC [Escherichia coli]
MSNNPLEVVTQAVNSLLTALKLPDESAQANQILGEMNFPQFSRLLPYRDYNQESGLFMNDSTMGFMLEAI
PINGANETIVEALDHMLRTKLPRGIPLCIHLMSSQLVGERIEYGLREFSWSGEQAERFNAITRAYYMKAA
ETLFPLPEGLNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGAYITTQTVDAQAFIDIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFRQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERIRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGW
RLLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKY
NQLFPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRQEG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

TraC protein (TraC_F_IV)

(39-277)

TraG P-loop domain (P-loop_TraG)

(468-771)

Family of unknown function (DUF5934) (DUF5934)

(290-447)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 24842..54943

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C9098_RS24645 (C9098_24680) 24208..24435 + 228 WP_000450527 toxin-antitoxin system antitoxin VapB -
C9098_RS24650 (C9098_24685) 24435..24833 + 399 WP_000911320 type II toxin-antitoxin system VapC family toxin -
C9098_RS24655 (C9098_24690) 24842..27031 - 2190 WP_136719386 type IV conjugative transfer system coupling protein TraD virb4
C9098_RS24660 (C9098_24695) 27313..27792 - 480 WP_001473214 hypothetical protein -
C9098_RS24665 (C9098_24700) 27996..28727 - 732 WP_001562867 conjugal transfer complement resistance protein TraT -
C9098_RS24670 (C9098_24705) 28776..29255 - 480 WP_062903572 surface exclusion protein -
C9098_RS24675 (C9098_24710) 29277..32120 - 2844 WP_052921638 conjugal transfer mating-pair stabilization protein TraG traG
C9098_RS24680 (C9098_24715) 32117..33490 - 1374 WP_000944332 conjugal transfer pilus assembly protein TraH traH
C9098_RS24685 (C9098_24720) 33477..33869 - 393 WP_000660704 F-type conjugal transfer protein TrbF -
C9098_RS24690 (C9098_24725) 33850..34197 - 348 WP_071532380 P-type conjugative transfer protein TrbJ -
C9098_RS24695 (C9098_24730) 34127..34672 - 546 WP_001457363 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
C9098_RS24700 (C9098_24735) 34659..34949 - 291 WP_021521297 type-F conjugative transfer system pilin chaperone TraQ -
C9098_RS24710 (C9098_24745) 35345..35686 - 342 WP_000556797 conjugal transfer protein TrbA -
C9098_RS24715 (C9098_24750) 35700..36443 - 744 WP_021573911 type-F conjugative transfer system pilin assembly protein TraF traF
C9098_RS24720 (C9098_24755) 36436..36693 - 258 WP_136719387 conjugal transfer protein TrbE -
C9098_RS24725 (C9098_24760) 36707..38611 - 1905 WP_047081608 type-F conjugative transfer system mating-pair stabilization protein TraN traN
C9098_RS24730 (C9098_24765) 38705..39085 - 381 WP_000056343 hypothetical protein -
C9098_RS24735 (C9098_24770) 39082..39720 - 639 WP_001035177 type-F conjugative transfer system pilin assembly protein TrbC trbC
C9098_RS24740 (C9098_24775) 39913..40152 + 240 WP_001066128 hypothetical protein -
C9098_RS24745 (C9098_24780) 40149..40328 - 180 WP_000970212 hypothetical protein -
C9098_RS24750 (C9098_24785) 40349..41341 - 993 WP_000817328 conjugal transfer pilus assembly protein TraU traU
C9098_RS24755 (C9098_24790) 41338..41970 - 633 WP_001203739 type-F conjugative transfer system protein TraW traW
C9098_RS24760 (C9098_24795) 41967..42353 - 387 WP_000214090 type-F conjugative transfer system protein TrbI -
C9098_RS24765 (C9098_24800) 42350..44980 - 2631 WP_136719388 type IV secretion system protein TraC virb4
C9098_RS24770 (C9098_24805) 45105..45452 - 348 WP_136719389 hypothetical protein -
C9098_RS25805 (C9098_24815) 45637..45855 - 219 WP_062855972 hypothetical protein -
C9098_RS24785 (C9098_24820) 45935..46408 - 474 WP_000549599 hypothetical protein -
C9098_RS24790 (C9098_24825) 46419..46814 - 396 WP_000549593 hypothetical protein -
C9098_RS24795 (C9098_24830) 46807..47028 - 222 WP_001278977 conjugal transfer protein TraR -
C9098_RS24800 (C9098_24835) 47163..47678 - 516 WP_000809868 type IV conjugative transfer system lipoprotein TraV traV
C9098_RS24805 (C9098_24840) 47675..47926 - 252 WP_001038341 conjugal transfer protein TrbG -
C9098_RS24810 (C9098_24845) 47919..48239 - 321 WP_001057270 conjugal transfer protein TrbD virb4
C9098_RS24815 (C9098_24850) 48226..48813 - 588 WP_021521307 conjugal transfer pilus-stabilizing protein TraP -
C9098_RS24820 (C9098_24855) 48803..50233 - 1431 WP_000146622 F-type conjugal transfer pilus assembly protein TraB traB
C9098_RS24825 (C9098_24860) 50233..50961 - 729 WP_001365587 type-F conjugative transfer system secretin TraK traK
C9098_RS24830 (C9098_24865) 50948..51514 - 567 WP_000399759 type IV conjugative transfer system protein TraE traE
C9098_RS24835 (C9098_24870) 51536..51847 - 312 WP_000012099 type IV conjugative transfer system protein TraL traL
C9098_RS24840 (C9098_24875) 51862..52215 - 354 WP_136719390 type IV conjugative transfer system pilin TraA -
C9098_RS24845 (C9098_24880) 52271..52645 - 375 WP_069190634 conjugal transfer relaxosome DNA-bindin protein TraY -
C9098_RS24850 (C9098_24885) 52744..53433 - 690 WP_136719391 conjugal transfer transcriptional regulator TraJ -
C9098_RS24855 (C9098_24890) 53618..54001 - 384 WP_032210979 conjugal transfer relaxosome DNA-binding protein TraM -
C9098_RS24860 (C9098_24895) 54353..54943 + 591 WP_277992774 transglycosylase SLT domain-containing protein virB1
C9098_RS24865 (C9098_24900) 55239..56060 - 822 WP_001234469 DUF932 domain-containing protein -
C9098_RS24870 (C9098_24905) 56178..56465 - 288 WP_000107526 hypothetical protein -
C9098_RS24880 (C9098_24915) 56621..56923 - 303 WP_024213649 hypothetical protein -
C9098_RS25810 57226..57398 + 173 Protein_74 hypothetical protein -
C9098_RS25815 57396..57626 - 231 WP_248842900 hypothetical protein -
C9098_RS24895 (C9098_24930) 57849..57971 - 123 WP_223200913 Hok/Gef family protein -
C9098_RS25820 57916..58068 - 153 Protein_77 DUF5431 family protein -
C9098_RS24900 (C9098_24935) 58218..58532 - 315 WP_001562885 hypothetical protein -
C9098_RS24905 (C9098_24940) 58529..59248 - 720 WP_001276237 plasmid SOS inhibition protein A -
C9098_RS24910 (C9098_24945) 59245..59679 - 435 WP_136719392 conjugation system SOS inhibitor PsiB -

Host bacterium

ID   3344 GenBank   NZ_RRKZ01000082
Plasmid name   FWSEC0322|unnamed2 Incompatibility group   IncFII
Plasmid size   66475 bp Coordinate of oriT [Strand]   54290..54375 [+]
Host baterium   Escherichia coli strain FWSEC0322

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -