Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102897
Name   oriT_pSE74-1357 in_silico
Organism   Salmonella enterica subsp. enterica serovar Enteritidis strain 74-1357
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP018643 (111288..111388 [+], 101 nt)
oriT length   101 nt
IRs (inverted repeats)      80..85, 91..96  (AAAAAA..TTTTTT)
 20..26, 38..44  (TAAATCA..TGATTTA)
Location of nic site      62..63
Conserved sequence flanking the
  nic site    		  GGTGTATAGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 101 nt

>oriT_pSE74-1357
TATTTATTTTTTTATTTTTTAAATCAGTGTGATAGCGTGATTTATCGCGCTGCGTTAGGTGTATAGCAGGTTAAGGGATAAAAAATCATCTTTTTTGGTAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2175 GenBank   WP_097478309
Name   TrwC_BTN71_RS24705_pSE74-1357 insolico UniProt ID   _
Length   1078 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 1078 a.a.        Molecular weight: 120193.44 Da        Isoelectric Point: 6.5766

>WP_097478309.1 MULTISPECIES: MobF family relaxase [Enterobacteriaceae]
MLDITTITRQNVTSVVGYYSDAKDDYYSKDSSFTSWQGTGAEALGLSGDVESARFKELLVGEIDTFTHMQ
RHVGDAKKERLGYDLTFSAPKGVSMQALIHGDKTIIEAHEKAVAAAVREAEKLAQARTTRQGKSVTQNTN
NLVVATFRHETSRALDPDLHTHAFVMNMTQREDGQWRALKNDELMRNKMHLGDVYKQELALELTKAGYEL
RYNSKNNTFDMAHFSDEQIRAFSRRSEQIEKGLAAMGLTRETADAQTKSRVSMATREKKTEHSREEIHQE
WASRAKTLGIDFDNREWQGHGKPLEADIARNMAPDFTSPEVKADRAIQFAVKSLSERDASFERQKLIQIA
NKQVLGHATIADVEKAYLKAVQKGAIIEGETRYQSTLKVGASVMAETLTRKEWIDSLTNSGMRADKARFA
VDDGIKNGRLKKTSHRVTTVEGIRLERSILTIESRGRGQMPRQLTAEIAGQLLAGKTLKKEQMRAVTEIV
TSKDRFVAAHGYAGTGKSYMTMAAKELLESQGLKVTALAPYGTQKKALEDDGLPARTVAAFLKAKDKKLD
EKSVVFIDEAGVIPARQMKQLMEVIEKHNARAVFLGDTSQTKAVEAGKPFEQLIKAGMQTSYMKDIQRQK
NEVLLEAVKYAAEGNAARALKNITGVNELKEEAPRLAQLADRYLSLSSEQQDATLIISGTNASRKTLNDY
IRGNLGLAGTGETFTLLDRVDSTQAERRDSRYFSKGQIIIPEQDYKNGMKRGESYQVLDTGPGNKLTVES
ISGEQIAFSPRTHTKLSVYQAVSAELAPGDKVMVTRNDKTLDVANGDRFTVKTVEGEKLTLEDKKGRTVE
LDKKQASYLSYAYATTVHKSQGLTCDRVLFNIDTKSLTTSKDVFYVGISRARHEVEIFTDDKKSLASSVS
RDSPKTTAAEIDRFFGLEARFKDIGRDTSLETRSAEKGLPEATGESMAFNQKPDEHNMTTGTDYQPVSNA
EDAFHLKQNPMDDSVGLRRHEAQQNDAELAHDYAAADDQQWSAQEYADYEHYAEASDYDFDSSIYDDYAM
PQTSQAEQSHTGKEHTHEHEHEEGGHEI

  Protein domains


Predicted by InterproScan.

UvrD-like helicase C-terminal domain (UvrD_C_2)

(851-895)

TrwC relaxase (TrwC)

(16-287)

AAA domain (AAA_30)

(477-653)


  Protein structure



No available structure.




Auxiliary protein

ID   881 GenBank   WP_000089263
Name   WP_000089263_pSE74-1357 insolico UniProt ID   A0A3U3XJL9
Length   75 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 75 a.a.        Molecular weight: 8541.74 Da        Isoelectric Point: 8.6796

>WP_000089263.1 MULTISPECIES: conjugal transfer relaxosome protein TraY [Gammaproteobacteria]
MSRNIIRPAPGNKVLLVLDDATNHKLLGARERSGRTKTNEVLVRLRDHLNRFPDFYNLDAIKEGAEETDS
IIKDL

  Protein domains


Predicted by InterproScan.

TraY domain (TraY)

(14-60)


  Protein structure


Source ID Structure
AlphaFold DB A0A3U3XJL9

ID   882 GenBank   WP_001354030
Name   WP_001354030_pSE74-1357 insolico UniProt ID   A0A734M5H3
Length   127 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 127 a.a.        Molecular weight: 14508.47 Da        Isoelectric Point: 4.7116

>WP_001354030.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Gammaproteobacteria]
MARVILYISNDVYDKVNAIVEQRRQEGARDKDISVSGTASMLLELGLRVYEAQMERKESAFNQTEFNKLL
LECVVKTQSSVAKILGIESLSPHVSGNPKFEYANMVEDIREKVSSEMERFFPKNDEE

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-126)


  Protein structure


Source ID Structure
AlphaFold DB A0A734M5H3

ID   883 GenBank   WP_000706094
Name   WP_000706094_pSE74-1357 insolico UniProt ID   B6UZ32
Length   96 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 96 a.a.        Molecular weight: 10829.54 Da        Isoelectric Point: 8.5040

>WP_000706094.1 MULTISPECIES: hypothetical protein [Enterobacterales]
MKIVADRLSDVNRKLDYLFDRASDADFGPLRDELKAITETLSGVKFPPAGQMMLHESLAIETLILLRSIA
EPGKTKAAKAEVERNGYKVWEPKKER

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB B6UZ32


T4CP

ID   1846 GenBank   WP_000069777
Name   traC_BTN71_RS24255_pSE74-1357 insolico UniProt ID   _
Length   876 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 876 a.a.        Molecular weight: 99195.86 Da        Isoelectric Point: 6.1126

>WP_000069777.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MSNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAI
PINGANKSIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAA
ATQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASIATQTVDAQAFIDIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLNVRADYLTLGLRENGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAGSPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGW
RLLDFKNRKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKY
NQLYPDQFQPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

Family of unknown function (DUF5934) (DUF5934)

(290-447)

TraG P-loop domain (P-loop_TraG)

(468-764)

TraC protein (TraC_F_IV)

(39-277)

  Protein structure



No available structure.



ID   1847 GenBank   WP_000342688
Name   t4cp2_BTN71_RS24710_pSE74-1357 insolico UniProt ID   _
Length   509 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 509 a.a.        Molecular weight: 57762.87 Da        Isoelectric Point: 9.6551

>WP_000342688.1 MULTISPECIES: type IV secretion system DNA-binding domain-containing protein [Enterobacterales]
MDDRERGLAFLFAITLPPVMVWFLVAKFTYGIDPSTAKYLIPYLVKNTFSLWPLWSALIAGWFIGVGGLI
AFIIYDKSRVFKGERFKKIYRGTELVRARTLADKTRERGVNQLTVANIPIPTYAENLHFSIAGTTGTGKT
TIFNELLFKSIIRGGKNIALDPNGGFLKNFYRPGDVILNAYDKRTEGWVFFNEIRRSYDYERLVNSIVQE
SPDMATEEWFGYGRLIFSEVSKKLHSLYSTVTMEEVIHWACNVDQKKLKEFLMGTPAEAIFSGSEKAVGS
ARFVLSKNLAPHLKMPEGNFSLRDWLDDGKPGTLFITWQEEMKRSLNPLISCWLDSIFSIVLGMGEKESR
INVFIDELESLQFLPNLNDALTKGRKSGLCVYAGYQTYSQLVKVYGRDMAQTILANMRSNIVLGGSRLGD
ETLDQMSRSLGEIEGEVERKESDPQKPWIVRKRRDVKVVRAVTPTEISMLPNLTGYLALPGDMPVAKFKA
KHVKYHRKNPVPGIELREI

  Protein domains


Predicted by InterproScan.

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(113-489)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 26370..50383

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BTN71_RS24145 (BTN71_23990) 21910..22122 - 213 WP_001309245 ANR family transcriptional regulator -
BTN71_RS24150 (BTN71_23995) 22251..22811 - 561 WP_000139323 fertility inhibition protein FinO -
BTN71_RS24155 (BTN71_24000) 22914..23774 - 861 WP_000704523 alpha/beta hydrolase -
BTN71_RS24160 (BTN71_24005) 23833..24078 - 246 Protein_29 TraX family protein -
BTN71_RS24165 (BTN71_24010) 24149..24886 - 738 WP_000199905 hypothetical protein -
BTN71_RS24170 (BTN71_24015) 25089..25820 - 732 WP_000782451 conjugal transfer complement resistance protein TraT -
BTN71_RS24175 (BTN71_24020) 25869..26354 - 486 WP_000605870 hypothetical protein -
BTN71_RS24180 (BTN71_24025) 26370..29192 - 2823 WP_001007039 conjugal transfer mating-pair stabilization protein TraG traG
BTN71_RS24185 (BTN71_24030) 29189..30562 - 1374 WP_000944331 conjugal transfer pilus assembly protein TraH traH
BTN71_RS24190 (BTN71_24035) 30549..30941 - 393 WP_000660699 F-type conjugal transfer protein TrbF -
BTN71_RS24195 (BTN71_24040) 30922..31269 - 348 WP_001309242 P-type conjugative transfer protein TrbJ -
BTN71_RS24200 (BTN71_24045) 31199..31744 - 546 WP_000059831 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
BTN71_RS24205 (BTN71_24050) 31731..32015 - 285 WP_000624194 type-F conjugative transfer system pilin chaperone TraQ -
BTN71_RS24210 (BTN71_24055) 32134..32478 - 345 WP_000556796 conjugal transfer protein TrbA -
BTN71_RS24215 (BTN71_24060) 32492..33235 - 744 WP_001030371 type-F conjugative transfer system pilin assembly protein TraF traF
BTN71_RS24220 (BTN71_24065) 33228..33485 - 258 WP_000864353 conjugal transfer protein TrbE -
BTN71_RS24225 (BTN71_24070) 33512..35362 - 1851 WP_000821856 type-F conjugative transfer system mating-pair stabilization protein TraN traN
BTN71_RS24230 (BTN71_24075) 35359..35997 - 639 WP_001080256 type-F conjugative transfer system pilin assembly protein TrbC trbC
BTN71_RS24235 (BTN71_24080) 36006..36311 - 306 WP_000224416 hypothetical protein -
BTN71_RS24240 (BTN71_24085) 36341..37333 - 993 WP_000830838 conjugal transfer pilus assembly protein TraU traU
BTN71_RS24245 (BTN71_24090) 37330..37962 - 633 WP_001203728 type-F conjugative transfer system protein TraW traW
BTN71_RS24250 (BTN71_24095) 37959..38345 - 387 WP_000214084 type-F conjugative transfer system protein TrbI -
BTN71_RS24255 (BTN71_24100) 38342..40972 - 2631 WP_000069777 type IV secretion system protein TraC virb4
BTN71_RS24260 (BTN71_24105) 41098..41445 - 348 WP_000836682 hypothetical protein -
BTN71_RS24265 (BTN71_24110) 41473..41691 - 219 WP_000556745 hypothetical protein -
BTN71_RS24270 (BTN71_24115) 41771..42244 - 474 WP_000549568 hypothetical protein -
BTN71_RS24275 (BTN71_24120) 42237..42650 - 414 WP_000549589 hypothetical protein -
BTN71_RS24280 (BTN71_24125) 42643..42864 - 222 WP_001278683 conjugal transfer protein TraR -
BTN71_RS24285 (BTN71_24130) 42999..43514 - 516 WP_000809881 type IV conjugative transfer system lipoprotein TraV traV
BTN71_RS24290 (BTN71_24135) 43511..43831 - 321 WP_001057307 conjugal transfer protein TrbD -
BTN71_RS24295 (BTN71_24140) 43818..44384 - 567 WP_000896599 conjugal transfer pilus-stabilizing protein TraP -
BTN71_RS24300 (BTN71_24145) 44374..45825 - 1452 WP_000146675 F-type conjugal transfer pilus assembly protein TraB traB
BTN71_RS24305 (BTN71_24150) 45825..46553 - 729 WP_001230772 type-F conjugative transfer system secretin TraK traK
BTN71_RS24310 (BTN71_24155) 46540..47106 - 567 WP_000399780 type IV conjugative transfer system protein TraE traE
BTN71_RS24315 (BTN71_24160) 47128..47439 - 312 WP_000012113 type IV conjugative transfer system protein TraL traL
BTN71_RS24320 (BTN71_24165) 47454..47813 - 360 WP_001098992 type IV conjugative transfer system pilin TraA -
BTN71_RS24325 (BTN71_24170) 47846..48073 - 228 WP_000089263 conjugal transfer relaxosome protein TraY -
BTN71_RS24330 (BTN71_24175) 48210..48881 - 672 WP_000283561 conjugal transfer transcriptional regulator TraJ -
BTN71_RS24335 (BTN71_24180) 49075..49458 - 384 WP_001354030 conjugal transfer relaxosome DNA-binding protein TraM -
BTN71_RS24345 (BTN71_24185) 49793..50383 + 591 WP_000252683 transglycosylase SLT domain-containing protein virB1
BTN71_RS24350 (BTN71_24190) 50680..51501 - 822 WP_001234445 DUF932 domain-containing protein -
BTN71_RS24355 (BTN71_24195) 51612..51908 - 297 WP_001272251 hypothetical protein -
BTN71_RS25030 52208..52504 + 297 Protein_68 hypothetical protein -
BTN71_RS24930 (BTN71_24215) 52820..52945 - 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
BTN71_RS25295 52887..53036 - 150 Protein_70 plasmid maintenance protein Mok -
BTN71_RS24380 (BTN71_24225) 53215..53977 - 763 Protein_71 plasmid SOS inhibition protein A -
BTN71_RS24385 (BTN71_24230) 53974..54408 - 435 WP_000845923 conjugation system SOS inhibitor PsiB -

Region 2: 78210..88535

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BTN71_RS24530 (BTN71_24385) 73753..74882 + 1130 WP_085959879 IS3-like element IS1133 family transposase -
BTN71_RS24535 (BTN71_24390) 75014..75817 + 804 WP_001082319 aminoglycoside O-phosphotransferase APH(3'')-Ib -
BTN71_RS24540 (BTN71_24395) 75817..76653 + 837 WP_000480968 aminoglycoside O-phosphotransferase APH(6)-Id -
BTN71_RS24545 (BTN71_24405) 76779..77090 - 312 WP_001452736 hypothetical protein -
BTN71_RS24550 (BTN71_24410) 77126..77440 - 315 WP_000734776 TrbM/KikA/MpfK family conjugal transfer protein -
BTN71_RS24555 (BTN71_24415) 77403..77780 - 378 WP_000504251 hypothetical protein -
BTN71_RS24560 (BTN71_24420) 77796..78101 - 306 WP_000960954 H-NS family nucleoid-associated regulatory protein -
BTN71_RS24565 (BTN71_24425) 78210..78944 + 735 WP_000033783 lytic transglycosylase domain-containing protein virB1
BTN71_RS24570 (BTN71_24430) 78953..79234 + 282 WP_000440698 transcriptional repressor KorA -
BTN71_RS24575 (BTN71_24435) 79244..79537 + 294 WP_000209137 TrbC/VirB2 family protein virB2
BTN71_RS24580 (BTN71_24440) 79587..79904 + 318 WP_000496058 VirB3 family type IV secretion system protein virB3
BTN71_RS24585 (BTN71_24445) 79904..82504 + 2601 WP_001200711 VirB4 family type IV secretion/conjugal transfer ATPase virb4
BTN71_RS24590 (BTN71_24450) 82522..83235 + 714 WP_000749362 type IV secretion system protein virB5
BTN71_RS24595 (BTN71_24455) 83243..83470 + 228 WP_000734973 IncN-type entry exclusion lipoprotein EexN -
BTN71_RS24600 (BTN71_24460) 83486..84526 + 1041 WP_000886022 type IV secretion system protein virB6
BTN71_RS25410 (BTN71_24465) 84627..84755 + 129 WP_071882546 conjugal transfer protein TraN -
BTN71_RS24610 (BTN71_24470) 84745..85443 + 699 WP_000646594 type IV secretion system protein virB8
BTN71_RS24615 (BTN71_24475) 85454..86338 + 885 WP_000735067 TrbG/VirB9 family P-type conjugative transfer protein virB9
BTN71_RS24620 (BTN71_24480) 86338..87498 + 1161 WP_000101711 type IV secretion system protein VirB10 virB10
BTN71_RS24625 (BTN71_24485) 87540..88535 + 996 WP_000128596 ATPase, T2SS/T4P/T4SS family virB11
BTN71_RS24630 (BTN71_24490) 88535..89068 + 534 WP_000731968 phospholipase D family protein -
BTN71_RS25415 89242..89637 - 396 WP_306766596 DUF6710 family protein -
BTN71_RS24640 (BTN71_24500) 89748..91499 - 1752 Protein_120 Tn3-like element TnAs1 family transposase -
BTN71_RS24645 (BTN71_24505) 91503..91895 + 393 WP_001351729 isochorismatase family cysteine hydrolase -
BTN71_RS24650 (BTN71_24510) 92033..92917 + 885 WP_000058717 EamA family transporter -

Host bacterium

ID   3340 GenBank   NZ_CP018643
Plasmid name   pSE74-1357 Incompatibility group   IncN
Plasmid size   118824 bp Coordinate of oriT [Strand]   111288..111388 [+]
Host baterium   Salmonella enterica subsp. enterica serovar Enteritidis strain 74-1357

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -