Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   102886
Name   oriT_pDSJ01 in_silico
Organism   Pantoea stewartii subsp. stewartii DC283
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP017582 (498..557 [-], 60 nt)
oriT length   60 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 60 nt

>oriT_pDSJ01
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   2166 GenBank   WP_167387068
Name   Relaxase_DSJ_RS27640_pDSJ01 insolico UniProt ID   _
Length   186 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 186 a.a.        Molecular weight: 20750.68 Da        Isoelectric Point: 9.6032

>WP_167387068.1 relaxase/mobilization nuclease domain-containing protein [Pantoea stewartii]
MIVKFHPRGRGGGAGPVDYLLGKDLQREGASVLQGKPEEVRELIDASPYAKKYTSGVLSFAEQDLPPGQR
EKLMASFERVLMPGLDKDQYSVLWVEHRDKGRLELNFLIPNTELLTGRRLQPYYDRADRPRIDAWQTIVN
GRLGLHDPNAPENRRALVTPSALPETKQEAAQAITRGLLALARPGS

  Protein domains


Predicted by InterproScan.

(56-177)


  Protein structure



No available structure.




Auxiliary protein


ID   874 GenBank   WP_151161160
Name   WP_151161160_pDSJ01 insolico UniProt ID   _
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11771.49 Da        Isoelectric Point: 7.8963

>WP_151161160.1 MobC family plasmid mobilization relaxosome protein [Pantoea stewartii]
MLTMWVTEDEHRRLLERCDGKQLAAWMRQTCLDEKPARAGKLPSLSPALLRQLAGMGNNLNQIARQVNSG
GGSGHDRVQVVAALMAIDAGLERLRHAVLEKGADDDR

  Protein domains


Predicted by InterproScan.

(50-94)


  Protein structure



No available structure.



ID   875 GenBank   WP_141119429
Name   WP_141119429_pDSJ01 insolico UniProt ID   _
Length   161 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 161 a.a.        Molecular weight: 18088.72 Da        Isoelectric Point: 10.0592

>WP_141119429.1 MbeB family mobilization protein [Pantoea stewartii]
MNSLLTLAKDLEQKSKVQQQSTGEMLKAAFSEHEKSVRAELSESEKRISAAILDHDRKLSSAMSQRTKGM
LRMVSQTWLTIVLVSVLLIASSAAILWWQSQQILDNYTTIREQKSTQAMLSERNSGVQLSTCGDQRRRCV
RVNPEAGRFGEDSSWMILAGK

  Protein domains


Predicted by InterproScan.

(1-52)


  Protein structure



No available structure.




Host bacterium


ID   3329 GenBank   NZ_CP017582
Plasmid name   pDSJ01 Incompatibility group   Col440II
Plasmid size   4277 bp Coordinate of oriT [Strand]   498..557 [-]
Host baterium   Pantoea stewartii subsp. stewartii DC283

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -