Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102879
Name   oriT_FWSEC0290|unnamed3 in_silico
Organism   Escherichia coli strain FWSEC0290
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_RRKF01000111 (2647..2732 [-], 86 nt)
oriT length   86 nt
IRs (inverted repeats)      61..68, 73..80  (TTGGTGGT..ACCACCAA)
 27..34, 37..44  (GCAAAAAC..GTTTTTGC)
Location of nic site      53..54
Conserved sequence flanking the
  nic site    		  GGTGTGGTGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 86 nt

>oriT_FWSEC0290|unnamed3
AACTACTTATTTGCAAAGAAAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   866 GenBank   WP_032210979
Name   WP_032210979_FWSEC0290|unnamed3 insolico UniProt ID   A0A234XLE3
Length   127 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 127 a.a.        Molecular weight: 14456.48 Da        Isoelectric Point: 5.0286

>WP_032210979.1 conjugal transfer relaxosome DNA-binding protein TraM [Escherichia coli]
MAKIQVYVNDHVSEKINAIAVQRRAEGAKEKDVSYSSIASMLLELGLRVYEAQMERKETAFNQTEFNKVL
LECVVKTQSSVAKILGIESLSPHVAGNPKFEYANMVEDIRDKVSVEMERFFPRNDEE

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-126)


  Protein structure


Source ID Structure
AlphaFold DB A0A234XLE3

ID   867 GenBank   WP_249528313
Name   WP_249528313_FWSEC0290|unnamed3 insolico UniProt ID   _
Length   126 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 126 a.a.        Molecular weight: 14741.00 Da        Isoelectric Point: 10.2984

>WP_249528313.1 conjugal transfer relaxosome DNA-bindin protein TraY [Escherichia coli]
MFLKRFGTRSATGKMVKLKLPVDVESLLIEASERSGRSRSFEAVIRLKDHLHRYPKFNRISNVYGKSLVK
YLTMRLDDETNKLLIAAKNRSGWCKTDEAADRVIDHLIKFPDFYNSEIYREATEQR

  Protein domains


Predicted by InterproScan.

TraY domain (TraY)

(72-118)

TraY domain (TraY)

(17-58)


  Protein structure



No available structure.




T4CP

ID   1826 GenBank   WP_136719388
Name   traC_C9077_RS25130_FWSEC0290|unnamed3 insolico UniProt ID   _
Length   876 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 876 a.a.        Molecular weight: 99502.21 Da        Isoelectric Point: 5.6231

>WP_136719388.1 type IV secretion system protein TraC [Escherichia coli]
MSNNPLEVVTQAVNSLLTALKLPDESAQANQILGEMNFPQFSRLLPYRDYNQESGLFMNDSTMGFMLEAI
PINGANETIVEALDHMLRTKLPRGIPLCIHLMSSQLVGERIEYGLREFSWSGEQAERFNAITRAYYMKAA
ETLFPLPEGLNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGAYITTQTVDAQAFIDIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFRQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERIRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGW
RLLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKY
NQLFPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRQEG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

TraC protein (TraC_F_IV)

(39-277)

TraG P-loop domain (P-loop_TraG)

(468-771)

Family of unknown function (DUF5934) (DUF5934)

(290-447)

  Protein structure



No available structure.



ID   1827 GenBank   WP_136769796
Name   traD_C9077_RS25240_FWSEC0290|unnamed3 insolico UniProt ID   _
Length   741 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 741 a.a.        Molecular weight: 84323.11 Da        Isoelectric Point: 5.1107

>WP_136769796.1 type IV conjugative transfer system coupling protein TraD [Escherichia coli]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWMLVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIRSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLASVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
KRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGESFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQARPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQPQQPQQ
PQQPQQPQQPQQPQQPQQPVSPAINDKKSDAGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMA
VYEAWQREQNPDIQQQMQRREEVNINVHRERGEDVEPGDDF

  Protein domains


Predicted by InterproScan.

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(173-560)

F sex factor protein N terminal (TraD_N)

(32-128)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 2079..32196

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C9077_RS25775 (C9077_25025) 1..71 + 71 Protein_0 single-stranded DNA-binding protein -
C9077_RS25015 (C9077_25030) 98..400 + 303 WP_024213649 hypothetical protein -
C9077_RS25025 (C9077_25040) 556..843 + 288 WP_000107542 hypothetical protein -
C9077_RS25030 (C9077_25045) 962..1783 + 822 WP_136763614 DUF932 domain-containing protein -
C9077_RS25035 (C9077_25050) 2079..2669 - 591 WP_279600944 transglycosylase SLT domain-containing protein virB1
C9077_RS25040 (C9077_25055) 3021..3404 + 384 WP_032210979 conjugal transfer relaxosome DNA-binding protein TraM -
C9077_RS25045 (C9077_25060) 3589..4278 + 690 WP_053265378 conjugal transfer transcriptional regulator TraJ -
C9077_RS25050 (C9077_25065) 4377..4751 + 375 WP_069190634 conjugal transfer relaxosome DNA-bindin protein TraY -
C9077_RS25055 (C9077_25070) 4807..5160 + 354 WP_136719390 type IV conjugative transfer system pilin TraA -
C9077_RS25060 (C9077_25075) 5175..5486 + 312 WP_000012099 type IV conjugative transfer system protein TraL traL
C9077_RS25065 (C9077_25080) 5508..6074 + 567 WP_000399759 type IV conjugative transfer system protein TraE traE
C9077_RS25070 (C9077_25085) 6061..6789 + 729 WP_001365587 type-F conjugative transfer system secretin TraK traK
C9077_RS25075 (C9077_25090) 6789..8219 + 1431 WP_000146622 F-type conjugal transfer pilus assembly protein TraB traB
C9077_RS25080 (C9077_25095) 8209..8796 + 588 WP_021521307 conjugal transfer pilus-stabilizing protein TraP -
C9077_RS25085 (C9077_25100) 8783..9103 + 321 WP_001057270 conjugal transfer protein TrbD virb4
C9077_RS25090 (C9077_25105) 9096..9347 + 252 WP_001038341 conjugal transfer protein TrbG -
C9077_RS25095 (C9077_25110) 9344..9859 + 516 WP_000809868 type IV conjugative transfer system lipoprotein TraV traV
C9077_RS25100 (C9077_25115) 9994..10215 + 222 WP_001278977 conjugal transfer protein TraR -
C9077_RS25105 (C9077_25120) 10208..10603 + 396 WP_000549593 hypothetical protein -
C9077_RS25110 (C9077_25125) 10614..11087 + 474 WP_000549599 hypothetical protein -
C9077_RS26180 (C9077_25130) 11167..11385 + 219 WP_062855972 hypothetical protein -
C9077_RS25125 (C9077_25140) 11570..11917 + 348 WP_136763612 hypothetical protein -
C9077_RS25130 (C9077_25145) 12042..14672 + 2631 WP_136719388 type IV secretion system protein TraC virb4
C9077_RS25135 (C9077_25150) 14669..15055 + 387 WP_000214090 type-F conjugative transfer system protein TrbI -
C9077_RS25140 (C9077_25155) 15052..15684 + 633 WP_001203739 type-F conjugative transfer system protein TraW traW
C9077_RS25145 (C9077_25160) 15681..16673 + 993 WP_000817328 conjugal transfer pilus assembly protein TraU traU
C9077_RS25150 (C9077_25165) 16694..16873 + 180 WP_000970212 hypothetical protein -
C9077_RS25160 (C9077_25175) 17303..17941 + 639 WP_001035177 type-F conjugative transfer system pilin assembly protein TrbC trbC
C9077_RS25165 (C9077_25180) 17938..18318 + 381 WP_000056343 hypothetical protein -
C9077_RS25170 (C9077_25185) 18412..20316 + 1905 WP_047081608 type-F conjugative transfer system mating-pair stabilization protein TraN traN
C9077_RS25175 (C9077_25190) 20330..20587 + 258 WP_136719387 conjugal transfer protein TrbE -
C9077_RS25180 (C9077_25195) 20580..21323 + 744 WP_021573911 type-F conjugative transfer system pilin assembly protein TraF traF
C9077_RS25185 (C9077_25200) 21337..21678 + 342 WP_000556797 conjugal transfer protein TrbA -
C9077_RS25195 (C9077_25210) 22074..22364 + 291 WP_021521297 type-F conjugative transfer system pilin chaperone TraQ -
C9077_RS25200 (C9077_25215) 22351..22896 + 546 WP_001477377 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
C9077_RS25205 (C9077_25220) 22826..23173 + 348 WP_071532380 P-type conjugative transfer protein TrbJ -
C9077_RS25210 (C9077_25225) 23154..23546 + 393 WP_000660704 F-type conjugal transfer protein TrbF -
C9077_RS25215 (C9077_25230) 23533..24906 + 1374 WP_000944332 conjugal transfer pilus assembly protein TraH traH
C9077_RS25220 (C9077_25235) 24903..27725 + 2823 WP_136763610 conjugal transfer mating-pair stabilization protein TraG traG
C9077_RS25225 (C9077_25240) 27747..28226 + 480 WP_062903572 surface exclusion protein -
C9077_RS25230 (C9077_25245) 28275..29006 + 732 WP_000782449 conjugal transfer complement resistance protein TraT -
C9077_RS25235 (C9077_25250) 29210..29689 + 480 WP_001473214 hypothetical protein -
C9077_RS25240 (C9077_25255) 29971..32196 + 2226 WP_136769796 type IV conjugative transfer system coupling protein TraD virb4
C9077_RS25245 (C9077_25260) 32205..32603 - 399 WP_136763606 type II toxin-antitoxin system VapC family toxin -
C9077_RS25250 (C9077_25265) 32603..32830 - 228 WP_000450527 toxin-antitoxin system antitoxin VapB -

Host bacterium

ID   3322 GenBank   NZ_RRKF01000111
Plasmid name   FWSEC0290|unnamed3 Incompatibility group   IncFII
Plasmid size   58960 bp Coordinate of oriT [Strand]   2647..2732 [-]
Host baterium   Escherichia coli strain FWSEC0290

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -