Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   102877
Name   oriT_pKp196; TIET-4200 in_silico
Organism   Klebsiella pneumoniae strain 196
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_KX397572 (13963..14062 [-], 100 nt)
oriT length   100 nt
IRs (inverted repeats)      77..82, 90..95  (AAAAAA..TTTTTT)
 78..83, 90..95  (AAAAAA..TTTTTT)
 79..84, 90..95  (AAAAAA..TTTTTT)
 20..26, 38..44  (TAAATCA..TGATTTA)
Location of nic site      62..63
Conserved sequence flanking the
  nic site  
 
 GGTGTATAGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 100 nt

>oriT_pKp196; TIET-4200
TATTTATTTTTTTATCTTTTAAATCAGTACGATAGCGTGATTTATCGCGCTGCGTTAGGTGTATAGCAGGTTAAGGAAAAAAAATCATCTTTTTTGGTAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1825 GenBank   WP_000342688
Name   t4cp2_A9Z47_RS00105_pKp196; TIET-4200 insolico UniProt ID   _
Length   509 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 509 a.a.        Molecular weight: 57762.87 Da        Isoelectric Point: 9.6551

>WP_000342688.1 MULTISPECIES: type IV secretion system DNA-binding domain-containing protein [Enterobacterales]
MDDRERGLAFLFAITLPPVMVWFLVAKFTYGIDPSTAKYLIPYLVKNTFSLWPLWSALIAGWFIGVGGLI
AFIIYDKSRVFKGERFKKIYRGTELVRARTLADKTRERGVNQLTVANIPIPTYAENLHFSIAGTTGTGKT
TIFNELLFKSIIRGGKNIALDPNGGFLKNFYRPGDVILNAYDKRTEGWVFFNEIRRSYDYERLVNSIVQE
SPDMATEEWFGYGRLIFSEVSKKLHSLYSTVTMEEVIHWACNVDQKKLKEFLMGTPAEAIFSGSEKAVGS
ARFVLSKNLAPHLKMPEGNFSLRDWLDDGKPGTLFITWQEEMKRSLNPLISCWLDSIFSIVLGMGEKESR
INVFIDELESLQFLPNLNDALTKGRKSGLCVYAGYQTYSQLVKVYGRDMAQTILANMRSNIVLGGSRLGD
ETLDQMSRSLGEIEGEVERKESDPQKPWIVRKRRDVKVVRAVTPTEISMLPNLTGYLALPGDMPVAKFKA
KHVKYHRKNPVPGIELREI

  Protein domains


Predicted by InterproScan.

(113-489)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 33233..43562

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A9Z47_RS00175 29161..29940 + 780 WP_004152394 IS21-like element ISKpn7 family helper ATPase IstB -
A9Z47_RS00185 30327..31208 + 882 WP_004199234 carbapenem-hydrolyzing class A beta-lactamase KPC-2 -
A9Z47_RS00190 31458..32777 - 1320 WP_004152397 IS1182-like element ISKpn6 family transposase -
A9Z47_RS28595 33129..33233 - 105 Protein_35 phospholipase D family protein -
A9Z47_RS00195 33233..34228 - 996 WP_012561144 ATPase, T2SS/T4P/T4SS family virB11
A9Z47_RS00200 34270..35430 - 1161 WP_000101710 type IV secretion system protein VirB10 virB10
A9Z47_RS00205 35430..36314 - 885 WP_000735066 TrbG/VirB9 family P-type conjugative transfer protein virB9
A9Z47_RS00210 36325..37023 - 699 WP_000646594 type IV secretion system protein virB8
A9Z47_RS29585 37013..37171 - 159 WP_012561180 hypothetical protein -
A9Z47_RS00220 37242..38282 - 1041 WP_001749958 type IV secretion system protein virB6
A9Z47_RS00225 38298..38525 - 228 WP_001749959 IncN-type entry exclusion lipoprotein EexN -
A9Z47_RS00230 38533..39246 - 714 WP_001749960 type IV secretion system protein virB5
A9Z47_RS00235 39264..41864 - 2601 WP_012561149 VirB4 family type IV secretion/conjugal transfer ATPase virb4
A9Z47_RS00240 41864..42181 - 318 WP_000496058 VirB3 family type IV secretion system protein virB3
A9Z47_RS00245 42232..42525 - 294 WP_001749962 hypothetical protein virB2
A9Z47_RS00250 42535..42816 - 282 WP_016338364 transcriptional repressor KorA -
A9Z47_RS00255 42825..43562 - 738 WP_013279384 lytic transglycosylase domain-containing protein virB1
A9Z47_RS00260 43605..43976 + 372 WP_223174968 H-NS family nucleoid-associated regulatory protein -
A9Z47_RS00265 43992..44336 + 345 WP_012561155 hypothetical protein -
A9Z47_RS00270 44333..44647 + 315 WP_016338363 TrbM/KikA/MpfK family conjugal transfer protein -
A9Z47_RS00275 44683..44994 + 312 WP_013279382 hypothetical protein -
A9Z47_RS29255 45050..45310 + 261 WP_016359294 hypothetical protein -
A9Z47_RS00285 45352..46320 - 969 WP_016151349 IS5 family transposase -
A9Z47_RS00290 46404..46757 + 354 WP_225622145 restriction endonuclease -
A9Z47_RS00295 46762..46968 + 207 WP_001749967 hypothetical protein -
A9Z47_RS00300 46979..47251 - 273 Protein_57 IS1 family transposase -


Host bacterium


ID   3320 GenBank   NZ_KX397572
Plasmid name   pKp196; TIET-4200 Incompatibility group   IncN
Plasmid size   55902 bp Coordinate of oriT [Strand]   13963..14062 [-]
Host baterium   Klebsiella pneumoniae strain 196

Cargo genes


Drug resistance gene   blaKPC-2
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -