Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 102877 |
Name | oriT_pKp196; TIET-4200 |
Organism | Klebsiella pneumoniae strain 196 |
Sequence Completeness | - |
NCBI accession of oriT (coordinates [strand]) | NZ_KX397572 (13963..14062 [-], 100 nt) |
oriT length | 100 nt |
IRs (inverted repeats) | 77..82, 90..95 (AAAAAA..TTTTTT) 78..83, 90..95 (AAAAAA..TTTTTT) 79..84, 90..95 (AAAAAA..TTTTTT) 20..26, 38..44 (TAAATCA..TGATTTA) |
Location of nic site | 62..63 |
Conserved sequence flanking the nic site |
GGTGTATAGC |
Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 100 nt
>oriT_pKp196; TIET-4200
TATTTATTTTTTTATCTTTTAAATCAGTACGATAGCGTGATTTATCGCGCTGCGTTAGGTGTATAGCAGGTTAAGGAAAAAAAATCATCTTTTTTGGTAG
TATTTATTTTTTTATCTTTTAAATCAGTACGATAGCGTGATTTATCGCGCTGCGTTAGGTGTATAGCAGGTTAAGGAAAAAAAATCATCTTTTTTGGTAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileT4CP
ID | 1825 | GenBank | WP_000342688 |
Name | t4cp2_A9Z47_RS00105_pKp196; TIET-4200 | UniProt ID | _ |
Length | 509 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
T4CP protein sequence
Download Length: 509 a.a. Molecular weight: 57762.87 Da Isoelectric Point: 9.6551
>WP_000342688.1 MULTISPECIES: type IV secretion system DNA-binding domain-containing protein [Enterobacterales]
MDDRERGLAFLFAITLPPVMVWFLVAKFTYGIDPSTAKYLIPYLVKNTFSLWPLWSALIAGWFIGVGGLI
AFIIYDKSRVFKGERFKKIYRGTELVRARTLADKTRERGVNQLTVANIPIPTYAENLHFSIAGTTGTGKT
TIFNELLFKSIIRGGKNIALDPNGGFLKNFYRPGDVILNAYDKRTEGWVFFNEIRRSYDYERLVNSIVQE
SPDMATEEWFGYGRLIFSEVSKKLHSLYSTVTMEEVIHWACNVDQKKLKEFLMGTPAEAIFSGSEKAVGS
ARFVLSKNLAPHLKMPEGNFSLRDWLDDGKPGTLFITWQEEMKRSLNPLISCWLDSIFSIVLGMGEKESR
INVFIDELESLQFLPNLNDALTKGRKSGLCVYAGYQTYSQLVKVYGRDMAQTILANMRSNIVLGGSRLGD
ETLDQMSRSLGEIEGEVERKESDPQKPWIVRKRRDVKVVRAVTPTEISMLPNLTGYLALPGDMPVAKFKA
KHVKYHRKNPVPGIELREI
MDDRERGLAFLFAITLPPVMVWFLVAKFTYGIDPSTAKYLIPYLVKNTFSLWPLWSALIAGWFIGVGGLI
AFIIYDKSRVFKGERFKKIYRGTELVRARTLADKTRERGVNQLTVANIPIPTYAENLHFSIAGTTGTGKT
TIFNELLFKSIIRGGKNIALDPNGGFLKNFYRPGDVILNAYDKRTEGWVFFNEIRRSYDYERLVNSIVQE
SPDMATEEWFGYGRLIFSEVSKKLHSLYSTVTMEEVIHWACNVDQKKLKEFLMGTPAEAIFSGSEKAVGS
ARFVLSKNLAPHLKMPEGNFSLRDWLDDGKPGTLFITWQEEMKRSLNPLISCWLDSIFSIVLGMGEKESR
INVFIDELESLQFLPNLNDALTKGRKSGLCVYAGYQTYSQLVKVYGRDMAQTILANMRSNIVLGGSRLGD
ETLDQMSRSLGEIEGEVERKESDPQKPWIVRKRRDVKVVRAVTPTEISMLPNLTGYLALPGDMPVAKFKA
KHVKYHRKNPVPGIELREI
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 33233..43562
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A9Z47_RS00175 | 29161..29940 | + | 780 | WP_004152394 | IS21-like element ISKpn7 family helper ATPase IstB | - |
A9Z47_RS00185 | 30327..31208 | + | 882 | WP_004199234 | carbapenem-hydrolyzing class A beta-lactamase KPC-2 | - |
A9Z47_RS00190 | 31458..32777 | - | 1320 | WP_004152397 | IS1182-like element ISKpn6 family transposase | - |
A9Z47_RS28595 | 33129..33233 | - | 105 | Protein_35 | phospholipase D family protein | - |
A9Z47_RS00195 | 33233..34228 | - | 996 | WP_012561144 | ATPase, T2SS/T4P/T4SS family | virB11 |
A9Z47_RS00200 | 34270..35430 | - | 1161 | WP_000101710 | type IV secretion system protein VirB10 | virB10 |
A9Z47_RS00205 | 35430..36314 | - | 885 | WP_000735066 | TrbG/VirB9 family P-type conjugative transfer protein | virB9 |
A9Z47_RS00210 | 36325..37023 | - | 699 | WP_000646594 | type IV secretion system protein | virB8 |
A9Z47_RS29585 | 37013..37171 | - | 159 | WP_012561180 | hypothetical protein | - |
A9Z47_RS00220 | 37242..38282 | - | 1041 | WP_001749958 | type IV secretion system protein | virB6 |
A9Z47_RS00225 | 38298..38525 | - | 228 | WP_001749959 | IncN-type entry exclusion lipoprotein EexN | - |
A9Z47_RS00230 | 38533..39246 | - | 714 | WP_001749960 | type IV secretion system protein | virB5 |
A9Z47_RS00235 | 39264..41864 | - | 2601 | WP_012561149 | VirB4 family type IV secretion/conjugal transfer ATPase | virb4 |
A9Z47_RS00240 | 41864..42181 | - | 318 | WP_000496058 | VirB3 family type IV secretion system protein | virB3 |
A9Z47_RS00245 | 42232..42525 | - | 294 | WP_001749962 | hypothetical protein | virB2 |
A9Z47_RS00250 | 42535..42816 | - | 282 | WP_016338364 | transcriptional repressor KorA | - |
A9Z47_RS00255 | 42825..43562 | - | 738 | WP_013279384 | lytic transglycosylase domain-containing protein | virB1 |
A9Z47_RS00260 | 43605..43976 | + | 372 | WP_223174968 | H-NS family nucleoid-associated regulatory protein | - |
A9Z47_RS00265 | 43992..44336 | + | 345 | WP_012561155 | hypothetical protein | - |
A9Z47_RS00270 | 44333..44647 | + | 315 | WP_016338363 | TrbM/KikA/MpfK family conjugal transfer protein | - |
A9Z47_RS00275 | 44683..44994 | + | 312 | WP_013279382 | hypothetical protein | - |
A9Z47_RS29255 | 45050..45310 | + | 261 | WP_016359294 | hypothetical protein | - |
A9Z47_RS00285 | 45352..46320 | - | 969 | WP_016151349 | IS5 family transposase | - |
A9Z47_RS00290 | 46404..46757 | + | 354 | WP_225622145 | restriction endonuclease | - |
A9Z47_RS00295 | 46762..46968 | + | 207 | WP_001749967 | hypothetical protein | - |
A9Z47_RS00300 | 46979..47251 | - | 273 | Protein_57 | IS1 family transposase | - |
Host bacterium
ID | 3320 | GenBank | NZ_KX397572 |
Plasmid name | pKp196; TIET-4200 | Incompatibility group | IncN |
Plasmid size | 55902 bp | Coordinate of oriT [Strand] | 13963..14062 [-] |
Host baterium | Klebsiella pneumoniae strain 196 |
Cargo genes
Drug resistance gene | blaKPC-2 |
Virulence gene | - |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | - |