Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 102862 |
| Name | oriT_pKPGJ-2b  |
| Organism | Klebsiella variicola strain GJ2 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP017851 (47554..47603 [-], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
| Location of nic site | 33..34 |
| Conserved sequence flanking the nic site |
GGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_pKPGJ-2b
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 1801 | GenBank | WP_060598860 |
| Name | traD_BBD64_RS28870_pKPGJ-2b |
UniProt ID | _ |
| Length | 766 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 766 a.a. Molecular weight: 85363.18 Da Isoelectric Point: 4.9167
>WP_060598860.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Klebsiella]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPDDAGSHAGEQPELASQPA
PAEVTVSPAPVKAPATTTMPAAEPSPRTAEPPVLRVTTVPLIKPKAAAAASTASSAGNPAAAAGGTEQEL
AQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPDDAGSHAGEQPELASQPA
PAEVTVSPAPVKAPATTTMPAAEPSPRTAEPPVLRVTTVPLIKPKAAAAASTASSAGNPAAAAGGTEQEL
AQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 50061..77702
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BBD64_RS28675 (BBD64_27050) | 46434..46964 | + | 531 | WP_077138878 | antirestriction protein | - |
| BBD64_RS28680 (BBD64_27055) | 47002..47409 | - | 408 | WP_224230374 | transglycosylase SLT domain-containing protein | - |
| BBD64_RS28685 (BBD64_27060) | 47903..48301 | + | 399 | WP_077138880 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| BBD64_RS28690 (BBD64_27065) | 48474..49160 | + | 687 | WP_077138881 | transcriptional regulator TraJ family protein | - |
| BBD64_RS28695 | 49239..49625 | + | 387 | WP_004152495 | TraY domain-containing protein | - |
| BBD64_RS28700 (BBD64_27075) | 49679..50047 | + | 369 | WP_049155512 | type IV conjugative transfer system pilin TraA | - |
| BBD64_RS28705 (BBD64_27080) | 50061..50366 | + | 306 | WP_004178059 | type IV conjugative transfer system protein TraL | traL |
| BBD64_RS28710 (BBD64_27085) | 50386..50952 | + | 567 | WP_004194424 | type IV conjugative transfer system protein TraE | traE |
| BBD64_RS28715 (BBD64_27090) | 50939..51679 | + | 741 | WP_060598874 | type-F conjugative transfer system secretin TraK | traK |
| BBD64_RS28720 (BBD64_27095) | 51679..53103 | + | 1425 | WP_060598873 | F-type conjugal transfer pilus assembly protein TraB | traB |
| BBD64_RS28725 (BBD64_27100) | 53096..53692 | + | 597 | WP_060598872 | conjugal transfer pilus-stabilizing protein TraP | - |
| BBD64_RS28730 | 53715..54299 | + | 585 | WP_060598871 | type IV conjugative transfer system lipoprotein TraV | traV |
| BBD64_RS28735 (BBD64_27105) | 54431..54841 | + | 411 | WP_060598870 | hypothetical protein | - |
| BBD64_RS28740 (BBD64_27110) | 54846..55130 | + | 285 | WP_060598886 | hypothetical protein | - |
| BBD64_RS28745 | 55154..55378 | + | 225 | WP_060598869 | hypothetical protein | - |
| BBD64_RS28750 (BBD64_27115) | 55371..55682 | + | 312 | WP_077138882 | hypothetical protein | - |
| BBD64_RS28755 (BBD64_27120) | 55749..56153 | + | 405 | WP_060598867 | hypothetical protein | - |
| BBD64_RS28760 (BBD64_27125) | 56196..56519 | + | 324 | WP_072124277 | hypothetical protein | - |
| BBD64_RS28765 (BBD64_27130) | 56527..56925 | + | 399 | WP_072198239 | hypothetical protein | - |
| BBD64_RS28770 (BBD64_27135) | 56997..59636 | + | 2640 | WP_060598865 | type IV secretion system protein TraC | virb4 |
| BBD64_RS28775 (BBD64_27140) | 59636..60025 | + | 390 | WP_020803372 | type-F conjugative transfer system protein TrbI | - |
| BBD64_RS28780 (BBD64_27145) | 60025..60651 | + | 627 | WP_020314628 | type-F conjugative transfer system protein TraW | traW |
| BBD64_RS28785 (BBD64_27150) | 60671..61654 | + | 984 | WP_223176982 | conjugal transfer pilus assembly protein TraU | traU |
| BBD64_RS28790 (BBD64_27155) | 61669..62217 | + | 549 | WP_022631518 | hypothetical protein | - |
| BBD64_RS28795 (BBD64_27160) | 62192..62881 | - | 690 | WP_032427592 | hypothetical protein | - |
| BBD64_RS28800 (BBD64_27165) | 62938..63540 | + | 603 | WP_077138883 | hypothetical protein | - |
| BBD64_RS28805 (BBD64_27170) | 63685..64332 | + | 648 | WP_039698503 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| BBD64_RS28810 (BBD64_27175) | 64391..66346 | + | 1956 | WP_060598862 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| BBD64_RS28815 (BBD64_27180) | 66379..66660 | + | 282 | WP_022644736 | hypothetical protein | - |
| BBD64_RS28820 (BBD64_27185) | 66650..66877 | + | 228 | WP_012540032 | conjugal transfer protein TrbE | - |
| BBD64_RS28825 (BBD64_27190) | 66888..67214 | + | 327 | WP_012539967 | hypothetical protein | - |
| BBD64_RS28830 (BBD64_27195) | 67235..67987 | + | 753 | WP_004152677 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| BBD64_RS28835 (BBD64_27200) | 67998..68237 | + | 240 | WP_023340931 | type-F conjugative transfer system pilin chaperone TraQ | - |
| BBD64_RS28840 (BBD64_27205) | 68209..68766 | + | 558 | WP_032433944 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| BBD64_RS28845 (BBD64_27210) | 68812..69255 | + | 444 | WP_040172400 | F-type conjugal transfer protein TrbF | - |
| BBD64_RS28850 (BBD64_27215) | 69233..70612 | + | 1380 | WP_072198238 | conjugal transfer pilus assembly protein TraH | traH |
| BBD64_RS28855 (BBD64_27220) | 70612..73434 | + | 2823 | WP_060598861 | conjugal transfer mating-pair stabilization protein TraG | traG |
| BBD64_RS30465 | 73458..74060 | + | 603 | WP_048263624 | hypothetical protein | - |
| BBD64_RS28865 (BBD64_27225) | 74311..75042 | + | 732 | WP_016831056 | conjugal transfer complement resistance protein TraT | - |
| BBD64_RS28870 (BBD64_27230) | 75402..77702 | + | 2301 | WP_060598860 | type IV conjugative transfer system coupling protein TraD | virb4 |
Host bacterium
| ID | 3305 | GenBank | NZ_CP017851 |
| Plasmid name | pKPGJ-2b | Incompatibility group | IncFIA |
| Plasmid size | 92232 bp | Coordinate of oriT [Strand] | 47554..47603 [-] |
| Host baterium | Klebsiella variicola strain GJ2 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |