Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 102859 |
| Name | oriT_pKPGJ-1b  |
| Organism | Klebsiella variicola strain GJ1 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP017281 (44404..44453 [-], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
| Location of nic site | 33..34 |
| Conserved sequence flanking the nic site |
GGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_pKPGJ-1b
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 1795 | GenBank | WP_060598860 |
| Name | traD_BBD63_RS00460_pKPGJ-1b |
UniProt ID | _ |
| Length | 766 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 766 a.a. Molecular weight: 85363.18 Da Isoelectric Point: 4.9167
>WP_060598860.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Klebsiella]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPDDAGSHAGEQPELASQPA
PAEVTVSPAPVKAPATTTMPAAEPSPRTAEPPVLRVTTVPLIKPKAAAAASTASSAGNPAAAAGGTEQEL
AQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPDDAGSHAGEQPELASQPA
PAEVTVSPAPVKAPATTTMPAAEPSPRTAEPPVLRVTTVPLIKPKAAAAASTASSAGNPAAAAGGTEQEL
AQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 46911..74552
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BBD63_RS00265 (BBD63_27005) | 43284..43814 | + | 531 | WP_077138878 | antirestriction protein | - |
| BBD63_RS00270 (BBD63_27010) | 43852..44259 | - | 408 | WP_224230374 | transglycosylase SLT domain-containing protein | - |
| BBD63_RS00275 (BBD63_27015) | 44753..45151 | + | 399 | WP_077138880 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| BBD63_RS00280 (BBD63_27020) | 45324..46010 | + | 687 | WP_077138881 | transcriptional regulator TraJ family protein | - |
| BBD63_RS00285 | 46089..46475 | + | 387 | WP_004152495 | TraY domain-containing protein | - |
| BBD63_RS00290 (BBD63_27030) | 46529..46897 | + | 369 | WP_049155512 | type IV conjugative transfer system pilin TraA | - |
| BBD63_RS00295 (BBD63_27035) | 46911..47216 | + | 306 | WP_004178059 | type IV conjugative transfer system protein TraL | traL |
| BBD63_RS00300 (BBD63_27040) | 47236..47802 | + | 567 | WP_004194424 | type IV conjugative transfer system protein TraE | traE |
| BBD63_RS00305 (BBD63_27045) | 47789..48529 | + | 741 | WP_060598874 | type-F conjugative transfer system secretin TraK | traK |
| BBD63_RS00310 (BBD63_27050) | 48529..49953 | + | 1425 | WP_060598873 | F-type conjugal transfer pilus assembly protein TraB | traB |
| BBD63_RS00315 (BBD63_27055) | 49946..50542 | + | 597 | WP_060598872 | conjugal transfer pilus-stabilizing protein TraP | - |
| BBD63_RS00320 | 50565..51149 | + | 585 | WP_060598871 | type IV conjugative transfer system lipoprotein TraV | traV |
| BBD63_RS00325 (BBD63_27060) | 51281..51691 | + | 411 | WP_060598870 | hypothetical protein | - |
| BBD63_RS00330 (BBD63_27065) | 51696..51980 | + | 285 | WP_060598886 | hypothetical protein | - |
| BBD63_RS00335 | 52004..52228 | + | 225 | WP_060598869 | hypothetical protein | - |
| BBD63_RS00340 (BBD63_27070) | 52221..52532 | + | 312 | WP_077138882 | hypothetical protein | - |
| BBD63_RS00345 (BBD63_27075) | 52599..53003 | + | 405 | WP_060598867 | hypothetical protein | - |
| BBD63_RS00350 (BBD63_27080) | 53046..53369 | + | 324 | WP_072124277 | hypothetical protein | - |
| BBD63_RS00355 (BBD63_27085) | 53377..53775 | + | 399 | WP_072198239 | hypothetical protein | - |
| BBD63_RS00360 (BBD63_27090) | 53847..56486 | + | 2640 | WP_060598865 | type IV secretion system protein TraC | virb4 |
| BBD63_RS00365 (BBD63_27095) | 56486..56875 | + | 390 | WP_020803372 | type-F conjugative transfer system protein TrbI | - |
| BBD63_RS00370 (BBD63_27100) | 56875..57501 | + | 627 | WP_020314628 | type-F conjugative transfer system protein TraW | traW |
| BBD63_RS00375 (BBD63_27105) | 57545..58504 | + | 960 | WP_029497356 | conjugal transfer pilus assembly protein TraU | traU |
| BBD63_RS00380 (BBD63_27110) | 58519..59067 | + | 549 | WP_022631518 | hypothetical protein | - |
| BBD63_RS00385 (BBD63_27115) | 59042..59731 | - | 690 | WP_032427592 | hypothetical protein | - |
| BBD63_RS00390 (BBD63_27120) | 59788..60390 | + | 603 | WP_077138883 | hypothetical protein | - |
| BBD63_RS00395 (BBD63_27125) | 60535..61182 | + | 648 | WP_039698503 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| BBD63_RS00400 (BBD63_27130) | 61241..63196 | + | 1956 | WP_060598862 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| BBD63_RS00405 (BBD63_27135) | 63229..63510 | + | 282 | WP_022644736 | hypothetical protein | - |
| BBD63_RS00410 (BBD63_27140) | 63500..63727 | + | 228 | WP_012540032 | conjugal transfer protein TrbE | - |
| BBD63_RS00415 (BBD63_27145) | 63738..64064 | + | 327 | WP_012539967 | hypothetical protein | - |
| BBD63_RS00420 (BBD63_27150) | 64085..64837 | + | 753 | WP_004152677 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| BBD63_RS00425 (BBD63_27155) | 64848..65087 | + | 240 | WP_023340931 | type-F conjugative transfer system pilin chaperone TraQ | - |
| BBD63_RS00430 (BBD63_27160) | 65059..65616 | + | 558 | WP_032433944 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| BBD63_RS00435 (BBD63_27165) | 65662..66105 | + | 444 | WP_040172400 | F-type conjugal transfer protein TrbF | - |
| BBD63_RS00440 (BBD63_27170) | 66083..67462 | + | 1380 | WP_072198238 | conjugal transfer pilus assembly protein TraH | traH |
| BBD63_RS00445 (BBD63_27175) | 67462..70284 | + | 2823 | WP_060598861 | conjugal transfer mating-pair stabilization protein TraG | traG |
| BBD63_RS29535 | 70308..70910 | + | 603 | WP_048263624 | hypothetical protein | - |
| BBD63_RS00455 (BBD63_27180) | 71161..71892 | + | 732 | WP_016831056 | conjugal transfer complement resistance protein TraT | - |
| BBD63_RS00460 (BBD63_27185) | 72252..74552 | + | 2301 | WP_060598860 | type IV conjugative transfer system coupling protein TraD | virb4 |
Host bacterium
| ID | 3302 | GenBank | NZ_CP017281 |
| Plasmid name | pKPGJ-1b | Incompatibility group | IncFIA |
| Plasmid size | 92219 bp | Coordinate of oriT [Strand] | 44404..44453 [-] |
| Host baterium | Klebsiella variicola strain GJ1 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |