Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 102856 |
| Name | oriT_pKPGJ-3b |
| Organism | Klebsiella variicola strain GJ3 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP017286 (61972..62021 [-], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
| Location of nic site | 33..34 |
| Conserved sequence flanking the nic site |
GGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_pKPGJ-3b
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 1792 | GenBank | WP_060598860 |
| Name | traD_BBD65_RS01205_pKPGJ-3b |
UniProt ID | _ |
| Length | 766 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 766 a.a. Molecular weight: 85363.18 Da Isoelectric Point: 4.9167
>WP_060598860.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Klebsiella]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPDDAGSHAGEQPELASQPA
PAEVTVSPAPVKAPATTTMPAAEPSPRTAEPPVLRVTTVPLIKPKAAAAASTASSAGNPAAAAGGTEQEL
AQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPDDAGSHAGEQPELASQPA
PAEVTVSPAPVKAPATTTMPAAEPSPRTAEPPVLRVTTVPLIKPKAAAAASTASSAGNPAAAAGGTEQEL
AQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 64479..92120
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BBD65_RS01010 (BBD65_27085) | 60852..61382 | + | 531 | WP_077138878 | antirestriction protein | - |
| BBD65_RS01015 (BBD65_27090) | 61420..61827 | - | 408 | WP_224230374 | transglycosylase SLT domain-containing protein | - |
| BBD65_RS01020 (BBD65_27095) | 62321..62719 | + | 399 | WP_077138880 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| BBD65_RS01025 (BBD65_27100) | 62892..63578 | + | 687 | WP_077138881 | transcriptional regulator TraJ family protein | - |
| BBD65_RS01030 | 63657..64043 | + | 387 | WP_004152495 | TraY domain-containing protein | - |
| BBD65_RS01035 (BBD65_27110) | 64097..64465 | + | 369 | WP_049155512 | type IV conjugative transfer system pilin TraA | - |
| BBD65_RS01040 (BBD65_27115) | 64479..64784 | + | 306 | WP_004178059 | type IV conjugative transfer system protein TraL | traL |
| BBD65_RS01045 (BBD65_27120) | 64804..65370 | + | 567 | WP_004194424 | type IV conjugative transfer system protein TraE | traE |
| BBD65_RS01050 (BBD65_27125) | 65357..66097 | + | 741 | WP_060598874 | type-F conjugative transfer system secretin TraK | traK |
| BBD65_RS01055 (BBD65_27130) | 66097..67521 | + | 1425 | WP_060598873 | F-type conjugal transfer pilus assembly protein TraB | traB |
| BBD65_RS01060 (BBD65_27135) | 67514..68110 | + | 597 | WP_060598872 | conjugal transfer pilus-stabilizing protein TraP | - |
| BBD65_RS01065 | 68133..68717 | + | 585 | WP_060598871 | type IV conjugative transfer system lipoprotein TraV | traV |
| BBD65_RS01070 (BBD65_27140) | 68849..69259 | + | 411 | WP_060598870 | hypothetical protein | - |
| BBD65_RS01075 (BBD65_27145) | 69264..69548 | + | 285 | WP_060598886 | hypothetical protein | - |
| BBD65_RS01080 | 69572..69796 | + | 225 | WP_060598869 | hypothetical protein | - |
| BBD65_RS01085 (BBD65_27150) | 69789..70100 | + | 312 | WP_077138882 | hypothetical protein | - |
| BBD65_RS01090 (BBD65_27155) | 70167..70571 | + | 405 | WP_060598867 | hypothetical protein | - |
| BBD65_RS01095 (BBD65_27160) | 70614..70937 | + | 324 | WP_072124277 | hypothetical protein | - |
| BBD65_RS01100 (BBD65_27165) | 70945..71343 | + | 399 | WP_072198239 | hypothetical protein | - |
| BBD65_RS01105 (BBD65_27170) | 71415..74054 | + | 2640 | WP_060598865 | type IV secretion system protein TraC | virb4 |
| BBD65_RS01110 (BBD65_27175) | 74054..74443 | + | 390 | WP_020803372 | type-F conjugative transfer system protein TrbI | - |
| BBD65_RS01115 (BBD65_27180) | 74443..75069 | + | 627 | WP_020314628 | type-F conjugative transfer system protein TraW | traW |
| BBD65_RS01120 (BBD65_27185) | 75113..76072 | + | 960 | WP_029497356 | conjugal transfer pilus assembly protein TraU | traU |
| BBD65_RS01125 (BBD65_27190) | 76087..76635 | + | 549 | WP_022631518 | hypothetical protein | - |
| BBD65_RS01130 (BBD65_27195) | 76610..77299 | - | 690 | WP_032427592 | hypothetical protein | - |
| BBD65_RS01135 (BBD65_27200) | 77356..77958 | + | 603 | WP_077138883 | hypothetical protein | - |
| BBD65_RS01140 (BBD65_27205) | 78103..78750 | + | 648 | WP_039698503 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| BBD65_RS01145 (BBD65_27210) | 78809..80764 | + | 1956 | WP_060598862 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| BBD65_RS01150 (BBD65_27215) | 80797..81078 | + | 282 | WP_022644736 | hypothetical protein | - |
| BBD65_RS01155 (BBD65_27220) | 81068..81295 | + | 228 | WP_012540032 | conjugal transfer protein TrbE | - |
| BBD65_RS01160 (BBD65_27225) | 81306..81632 | + | 327 | WP_012539967 | hypothetical protein | - |
| BBD65_RS01165 (BBD65_27230) | 81653..82405 | + | 753 | WP_004152677 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| BBD65_RS01170 (BBD65_27235) | 82416..82655 | + | 240 | WP_023340931 | type-F conjugative transfer system pilin chaperone TraQ | - |
| BBD65_RS01175 (BBD65_27240) | 82627..83184 | + | 558 | WP_032433944 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| BBD65_RS01180 (BBD65_27245) | 83230..83673 | + | 444 | WP_040172400 | F-type conjugal transfer protein TrbF | - |
| BBD65_RS01185 (BBD65_27250) | 83651..85030 | + | 1380 | WP_072198238 | conjugal transfer pilus assembly protein TraH | traH |
| BBD65_RS01190 (BBD65_27255) | 85030..87852 | + | 2823 | WP_060598861 | conjugal transfer mating-pair stabilization protein TraG | traG |
| BBD65_RS30065 | 87876..88478 | + | 603 | WP_048263624 | hypothetical protein | - |
| BBD65_RS01200 (BBD65_27260) | 88729..89460 | + | 732 | WP_016831056 | conjugal transfer complement resistance protein TraT | - |
| BBD65_RS01205 (BBD65_27265) | 89820..92120 | + | 2301 | WP_060598860 | type IV conjugative transfer system coupling protein TraD | virb4 |
Host bacterium
| ID | 3299 | GenBank | NZ_CP017286 |
| Plasmid name | pKPGJ-3b | Incompatibility group | IncFII |
| Plasmid size | 92231 bp | Coordinate of oriT [Strand] | 61972..62021 [-] |
| Host baterium | Klebsiella variicola strain GJ3 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |