Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102848
Name   oriT_pATCC10720 in_silico
Organism   Salmonella enterica subsp. enterica serovar Inverness str. ATCC 10720
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP019182 (81144..81224 [-], 81 nt)
oriT length   81 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 81 nt

>oriT_pATCC10720
GGGACAAGATGTGTTTTGTAGCACCGCCTGCACGCAGTCGGCCCTACAAAACTCTTGGTCAGGGCGAAGCCCCGACACCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2121 GenBank   WP_023228549
Name   Relaxase_SEEI0720_RS25115_pATCC10720 insolico UniProt ID   A0A8E9YRS2
Length   651 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 651 a.a.        Molecular weight: 75026.55 Da        Isoelectric Point: 7.1085

>WP_023228549.1 TraI/MobA(P) family conjugative relaxase [Salmonella enterica]
MIGRIPPKRRDGKSSFLKLVAYSVIRDEDKPDVPLEPDHPDWRRPKSKDEIFNRLTDYITRSGDESIMQT
LSTDEYGRQRVLFDGVMCETNTFSLATAAIEMNAVALQNTRCKDPVLHYFLSWPVTDNPTHDQIFDSVRQ
SLIEFGVEEHQYVAAIHTDTNNIHCHIAANRIHPETYKAADDSYTFRKLQRVLRKLELKHNWTPTNGKRD
EPPVPQGAVAMEYYADQESLHSYSMRTCADDMEKLIVREDLTWKDVHKLLVRQGLKIDRKGKGLAIWSLD
EPDITPIKASNLHPDLTLSCLEDDLGSFERMEDVGRYTLDENDAGEDALIHMYRYEPALHKRDEGARAAR
REARAAARRELFDRYKKYSDGFKRPKMESTEATKQFKALSNRYAWKKEQVRYVFDDPLIRKVVYRVLEAE
RQKEYEALKAQIKKEKAAFYKDPVNRKLTRQEWVAQQALKQDQAAISCLRGWSYRYKRNALTPSLSENAI
VCAVADDIRPYNVQSYETSVNRDGTIQYKQNGIVQIQDKGDRIEIADPYTQGGQHIAGAMVIAEEKSGEK
MQFSGDSAFVGAACNIVPWFNSGGEKPLPLTDPRQRVMAGYDKPETHSDRPVMTHRIVDEETYLASRQGV
RAVDDRETDELKPEKNTHRLR

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(88-305)


  Protein structure



No available structure.




T4CP

ID   1783 GenBank   WP_023228536
Name   trbC_SEEI0720_RS25035_pATCC10720 insolico UniProt ID   _
Length   731 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 731 a.a.        Molecular weight: 82972.42 Da        Isoelectric Point: 8.0339

>WP_023228536.1 F-type conjugative transfer protein TrbC [Salmonella enterica]
MTTGNTQPVDKQRVRQITQSTWMDDYLLAPATVQAGLVVILVLTFLRTWILLPGVFATSIWLLTFFGQLF
RMPLRMPKDIGGFDMTTERENALEFKGPMGLFRFTRRRLTWEKSAGIMCLGHARRRFLGRELWLTRDDCL
RHMQLLATTGSGKTEALLSLQLNSLCMGRGMMFSDGKAETKLAYAIWSLMRRYGQEDNYYVLNFLNGGRD
RFDELLGNDRTRPQSNSINFFSDATATFIIQLMESLLPQVGSNEAGWQDKAKPMLYGLVYALYYKCRKDN
IRLSQSMIQKHLPLKEMADLYIEAKQNGWHDEAVSALEAYLSNLAGFRMELVSKSSEWDQGVYDQHGFLT
QQFSRMLAMFNDVYGHIFSSDAGDIDLSDVLHNDRTLVVLIPALELSKSESANLGKLYISAKRMVIARDL
GYQLEGKSRDVLTSAKFYNPFPFPDVHDELGSYFAPGMDDLAAQMRSLGVMLVISAQDIQRFVAQFKGEY
QTVNANTLVKWFMAMQDEKDTFELAKATAGKDYYAELGEMKRTPGTVSSSYEEANTTYIREKNRITLDEL
KDLNPGEGFISFKSALVPGSAIYIPDSEKISSKLSLRINRFIDTGKPTEADLVAQNPHLRRLLPPSELEV
SMLLQRTDEIIAGSETHTLPPLMDPILARLMKVALDLDNRCDISYTPTQRGILLFEAARDVLKKRGKKWF
TVKTQPNPLRVSDAMAHRLARKSTAFMSQEQ

  Protein domains


Predicted by InterproScan.

TraM recognition site of TraD and TraG (TraG-D_C)

(448-563)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 30472..63535

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SEEI0720_RS24845 (SEEI0720_024860) 26367..26561 + 195 WP_023228583 TcpQ domain-containing protein -
SEEI0720_RS24850 (SEEI0720_024865) 26561..26992 + 432 WP_001128317 type IV pilus biogenesis protein PilM -
SEEI0720_RS24855 (SEEI0720_024870) 27007..28629 + 1623 WP_023228584 PilN family type IVB pilus formation outer membrane protein -
SEEI0720_RS24860 (SEEI0720_024875) 28634..29917 + 1284 WP_023228585 type 4b pilus protein PilO2 -
SEEI0720_RS24865 (SEEI0720_024880) 29904..30440 + 537 WP_023228586 type IV pilus biogenesis protein PilP -
SEEI0720_RS24870 (SEEI0720_024885) 30472..31971 + 1500 WP_023228587 ATPase, T2SS/T4P/T4SS family virB11
SEEI0720_RS24875 (SEEI0720_024890) 31964..33079 + 1116 WP_023228588 type II secretion system F family protein -
SEEI0720_RS24880 (SEEI0720_024895) 33106..33699 + 594 WP_001627951 type 4 pilus major pilin -
SEEI0720_RS24885 (SEEI0720_024900) 33713..34183 + 471 WP_000279780 lytic transglycosylase domain-containing protein virB1
SEEI0720_RS24890 (SEEI0720_024905) 34183..34794 + 612 WP_001055328 prepilin peptidase -
SEEI0720_RS24895 (SEEI0720_024910) 34896..36200 + 1305 WP_070793466 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
SEEI0720_RS24900 (SEEI0720_024915) 36284..36670 - 387 Protein_30 phage tail protein -
SEEI0720_RS24905 (SEEI0720_024920) 36755..37909 + 1155 WP_000089546 site-specific integrase -
SEEI0720_RS24910 (SEEI0720_024925) 38034..38489 + 456 WP_000775487 DotD/TraH family lipoprotein -
SEEI0720_RS24915 (SEEI0720_024930) 38486..39307 + 822 WP_023228522 type IV secretory system conjugative DNA transfer family protein traI
SEEI0720_RS24920 (SEEI0720_024935) 39304..40473 + 1170 WP_001627957 plasmid transfer ATPase TraJ virB11
SEEI0720_RS24925 (SEEI0720_024940) 40463..40729 + 267 WP_001627958 IcmT/TraK family protein traK
SEEI0720_RS24930 (SEEI0720_024945) 40741..44175 + 3435 WP_001627959 DUF5710 domain-containing protein -
SEEI0720_RS24935 (SEEI0720_024950) 44191..44661 + 471 WP_000735118 hypothetical protein traL
SEEI0720_RS24940 (SEEI0720_024955) 44724..45401 + 678 WP_024148339 DotI/IcmL/TraM family protein traM
SEEI0720_RS24945 (SEEI0720_024960) 45398..46450 + 1053 WP_024148340 DotH/IcmK family type IV secretion protein traN
SEEI0720_RS24950 (SEEI0720_024965) 46450..47652 + 1203 WP_001627964 conjugal transfer protein TraO traO
SEEI0720_RS24955 (SEEI0720_024970) 47649..48404 + 756 WP_001627965 conjugal transfer protein TraP traP
SEEI0720_RS24960 (SEEI0720_024975) 48414..48944 + 531 WP_001627966 conjugal transfer protein TraQ traQ
SEEI0720_RS24965 (SEEI0720_024980) 48960..49358 + 399 WP_001627967 DUF6750 family protein traR
SEEI0720_RS24970 (SEEI0720_024985) 49416..49868 + 453 WP_023228524 hypothetical protein -
SEEI0720_RS24975 (SEEI0720_024990) 49973..50239 + 267 WP_001627968 hypothetical protein -
SEEI0720_RS24980 (SEEI0720_024995) 50333..50941 + 609 WP_023228525 hypothetical protein traT
SEEI0720_RS24985 (SEEI0720_025000) 50970..54002 + 3033 WP_235614366 ATP-binding protein traU
SEEI0720_RS24990 (SEEI0720_025005) 54075..55247 + 1173 WP_235614367 conjugal transfer protein TraW traW
SEEI0720_RS24995 (SEEI0720_025010) 55244..55762 + 519 WP_001627974 conjugal transfer protein TraX -
SEEI0720_RS25000 (SEEI0720_025015) 55813..57960 + 2148 WP_023228529 DotA/TraY family protein traY
SEEI0720_RS25005 (SEEI0720_025020) 57968..58462 + 495 WP_023228530 hypothetical protein -
SEEI0720_RS25010 (SEEI0720_025025) 58563..59078 - 516 WP_023228531 GNAT family N-acetyltransferase -
SEEI0720_RS25015 (SEEI0720_025030) 59062..59355 - 294 WP_000987497 DUF1778 domain-containing protein -
SEEI0720_RS26295 59444..59602 - 159 WP_001627977 hypothetical protein -
SEEI0720_RS25020 (SEEI0720_025035) 59827..60480 + 654 WP_023228533 DUF5710 domain-containing protein -
SEEI0720_RS26865 60887..60982 + 96 WP_000247681 DinQ-like type I toxin DqlB -
SEEI0720_RS25025 (SEEI0720_025040) 61127..62425 + 1299 WP_024148342 hypothetical protein trbA
SEEI0720_RS25030 (SEEI0720_025045) 62516..63535 + 1020 WP_023228535 thioredoxin fold domain-containing protein trbB
SEEI0720_RS25035 (SEEI0720_025050) 63522..65717 + 2196 WP_023228536 F-type conjugative transfer protein TrbC -
SEEI0720_RS25040 (SEEI0720_025055) 65776..66315 + 540 WP_026037017 phospholipase D family protein -
SEEI0720_RS25045 (SEEI0720_025060) 66410..66973 + 564 WP_023228537 DUF2913 family protein -
SEEI0720_RS25050 (SEEI0720_025065) 67542..68138 - 597 WP_000928861 dienelactone hydrolase family protein -

Host bacterium

ID   3291 GenBank   NZ_CP019182
Plasmid name   pATCC10720 Incompatibility group   IncFIB
Plasmid size   124201 bp Coordinate of oriT [Strand]   81144..81224 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Inverness str. ATCC 10720

Cargo genes

Drug resistance gene   -
Virulence gene   iroN, pefD
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIB