Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102840
Name   oriT_FWSEC0093|unnamed1 in_silico
Organism   Escherichia coli strain FWSEC0093
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_RRFL01000154 (29816..29901 [+], 86 nt)
oriT length   86 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 86 nt

>oriT_FWSEC0093|unnamed1
CGGGGTGTCGGGGCTAAGCCCTGACCAGGTGGTAATCGTATAGCCGTGCGTGCGCGGTTATACGATTACACATCCTGTCCCGTTTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2112 GenBank   WP_033810803
Name   Relaxase_C9Z43_RS26620_FWSEC0093|unnamed1 insolico UniProt ID   A0A2Y0QKF4
Length   900 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 900 a.a.        Molecular weight: 104058.75 Da        Isoelectric Point: 9.2345

>WP_033810803.1 relaxase/mobilization nuclease domain-containing protein [Escherichia coli]
MNAIIPKKRRDGKSSFEDLIAYTSVRDDVPEDELRPDTEVKGEVPHRNRFRRLVDYATRLRNEKFVSLID
VMKDGSQWVNFYGVTCFHNCLSLESAAEEMQKAADLAHFSKDDTDPVFHYILSWPAHESPRSEQLFDCVR
HTLKSLELSKHQYVAAVHTDTDNLHVHVAVNRVHPETGYINCLPWSQEKLSRACRELELKHGFAPDNGCF
VHAPGNRIVRKTALVRERRNAWRRGKKQTFREYIAQMSIAGLREEPAQDWLSLHKRLASDGLYITMQEGE
LVVKDGWDRAREGVALSSFGPSWTAEKLGRKLGEYQPVPTDIFSQVGTPGRYDPEAINVDIRPEKVAETE
SLKQYACRHFAERLPAMARNGELKSCLAVHRTLAEAGLWMGIQHGHLVLHDGFDKQQTPVRADSVWPLLT
LENIRKLNGGWQSVPKDIFTQVVPQSRFSGHRMDMHPVSDHEWHRMRTGAGPQGAIKREIFSDKESLWGY
AVSHCARDIQYMISEGRFSWQNCHELFARSGLMLQKLHHGLVIVDAFNHDQTPVKASSIHPDLTLSRAEP
QAGPFEIAAADIFDRVKPESRYNPDMAVSDSKEPGFKRDPELRRRRRETRAAAREDLRARYLAWKEHWRK
PDLRYGERLREVHAACRRRKAHIRVQFRDPQVRKLHYHIAEVQRMQALIRLKESVREERLSLMAEGKWYP
LSYRQWVEQMAVQGDSAAVSQLRGWNYRDRRNDEVLLTTPQRCVVLCEPGSTPIHRDIGGMVATLQRNGS
VRFRDATTGEYVCTDYGDRVVFSNSADNKTLKKRMVRVSSVLFARDPRMGFEPEGQDAQFNRMFADMVAW
KNVQRDERKGHYRISRSDVDQLRVSSEKRFRDYLKGRDTESHTYHHATDENKWEPPSPGM

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(62-315)


  Protein structure


Source ID Structure
AlphaFold DB A0A2Y0QKF4


Auxiliary protein

ID   850 GenBank   WP_001291056
Name   WP_001291056_FWSEC0093|unnamed1 insolico UniProt ID   A0A4P8CE48
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12597.68 Da        Isoelectric Point: 10.6096

>WP_001291056.1 MULTISPECIES: plasmid mobilization protein MobA [Enterobacteriaceae]
MSEKKTRSGSEKRQKNVLIAVRFSPEEAEIVKEKAEKNGLTVSTLIRKTVLGKQINARIDEDFLKELMRL
GRLQKHLFVEGKRTGDKEYAEVLVAITELANTLRRDLMGR

  Protein domains


Predicted by InterproScan.

Family of unknown function (DUF6290) (DUF6290)

(19-66)


  Protein structure


Source ID Structure
AlphaFold DB A0A4P8CE48


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 1..20628

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C9Z43_RS26465 (C9Z43_26480) 1..828 + 828 WP_136768103 DotH/IcmK family type IV secretion protein traN
C9Z43_RS26470 (C9Z43_26485) 832..2163 + 1332 WP_001272016 conjugal transfer protein TraO traO
C9Z43_RS26475 (C9Z43_26490) 2160..2873 + 714 WP_136768104 conjugal transfer protein TraP traP
C9Z43_RS26480 (C9Z43_26495) 2870..3400 + 531 WP_001563242 conjugal transfer protein TraQ traQ
C9Z43_RS26485 (C9Z43_26500) 3447..3845 + 399 WP_021293311 DUF6750 family protein traR
C9Z43_RS27955 (C9Z43_26505) 3902..4153 + 252 WP_021292797 hypothetical protein -
C9Z43_RS26495 (C9Z43_26510) 4068..4886 + 819 WP_169300715 conjugal transfer protein TraT traT
C9Z43_RS26500 (C9Z43_26515) 4941..5300 + 360 WP_000380400 hypothetical protein -
C9Z43_RS26505 (C9Z43_26520) 5300..5680 + 381 WP_087634464 hypothetical protein -
C9Z43_RS26510 (C9Z43_26525) 5856..8900 + 3045 WP_021552467 hypothetical protein traU
C9Z43_RS26515 (C9Z43_26530) 8900..9520 + 621 WP_000286858 hypothetical protein traV
C9Z43_RS26520 (C9Z43_26535) 9478..10683 + 1206 WP_169300716 conjugal transfer protein TraW traW
C9Z43_RS26525 (C9Z43_26540) 10680..11249 + 570 WP_136768105 conjugal transfer protein TraX -
C9Z43_RS26530 (C9Z43_26545) 11322..13487 + 2166 WP_000691806 DotA/TraY family protein traY
C9Z43_RS26535 (C9Z43_26550) 13558..14208 + 651 WP_136768106 plasmid IncI1-type surface exclusion protein ExcA -
C9Z43_RS26545 (C9Z43_26560) 14522..14674 - 153 WP_001444391 Hok/Gef family protein -
C9Z43_RS26550 (C9Z43_26565) 15003..15245 + 243 WP_000650933 hypothetical protein -
C9Z43_RS26555 (C9Z43_26570) 15341..15532 + 192 WP_033810774 hypothetical protein -
C9Z43_RS26560 (C9Z43_26575) 15544..15927 + 384 WP_001681657 hypothetical protein -
C9Z43_RS26565 (C9Z43_26580) 15915..16127 + 213 WP_000264905 hypothetical protein -
C9Z43_RS26575 (C9Z43_26590) 16325..16948 - 624 WP_136768107 DNA-binding protein -
C9Z43_RS26580 (C9Z43_26595) 17113..17580 + 468 WP_062891151 thermonuclease family protein -
C9Z43_RS27220 17731..17907 + 177 WP_001054907 hypothetical protein -
C9Z43_RS26585 (C9Z43_26600) 18245..19507 + 1263 WP_033810776 IncI1-type conjugal transfer protein TrbA trbA
C9Z43_RS26590 (C9Z43_26605) 19504..20628 + 1125 WP_136768108 DsbC family protein trbB
C9Z43_RS26595 (C9Z43_26610) 20609..22882 + 2274 WP_349815407 F-type conjugative transfer protein TrbC -
C9Z43_RS26600 (C9Z43_26615) 23016..24224 + 1209 WP_136768109 type II restriction endonuclease -

Host bacterium

ID   3283 GenBank   NZ_RRFL01000154
Plasmid name   FWSEC0093|unnamed1 Incompatibility group   -
Plasmid size   30985 bp Coordinate of oriT [Strand]   29816..29901 [+]
Host baterium   Escherichia coli strain FWSEC0093

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -