Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 102838 |
| Name | oriT_pCFSAN001297_02  |
| Organism | Salmonella enterica subsp. enterica serovar Muenster str. 0315 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP019199 (46398..46450 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pCFSAN001297_02
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 1770 | GenBank | WP_000338974 |
| Name | t4cp2_SEEM0315_RS25005_pCFSAN001297_02 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73347.89 Da Isoelectric Point: 9.1391
>WP_000338974.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 5281..28467
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SEEM0315_RS27025 | 1674..1979 | - | 306 | WP_235613330 | pilus assembly protein PilV | - |
| SEEM0315_RS27125 (SEEM0315_024975) | 3042..3263 | + | 222 | Protein_3 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| SEEM0315_RS24955 (SEEM0315_024980) | 3415..4629 | - | 1215 | WP_235613331 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| SEEM0315_RS24960 (SEEM0315_024985) | 4642..5277 | - | 636 | WP_000934979 | A24 family peptidase | - |
| SEEM0315_RS24965 (SEEM0315_024990) | 5281..5763 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| SEEM0315_RS24970 (SEEM0315_024995) | 5829..6386 | - | 558 | WP_000095048 | type 4 pilus major pilin | - |
| SEEM0315_RS24975 (SEEM0315_025000) | 6431..7540 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
| SEEM0315_RS24980 (SEEM0315_025005) | 7531..9069 | - | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
| SEEM0315_RS24985 (SEEM0315_025010) | 9094..9588 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| SEEM0315_RS24990 (SEEM0315_025015) | 9572..10882 | - | 1311 | WP_001454111 | type 4b pilus protein PilO2 | - |
| SEEM0315_RS24995 (SEEM0315_025020) | 10933..12576 | - | 1644 | WP_001035589 | PilN family type IVB pilus formation outer membrane protein | - |
| SEEM0315_RS25000 (SEEM0315_025025) | 12569..13087 | - | 519 | WP_010895890 | sigma 54-interacting transcriptional regulator | virb4 |
| SEEM0315_RS25005 (SEEM0315_025030) | 13134..15092 | - | 1959 | WP_000338974 | type IV secretory system conjugative DNA transfer family protein | - |
| SEEM0315_RS25010 (SEEM0315_025035) | 15108..16163 | - | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| SEEM0315_RS25015 (SEEM0315_025040) | 16238..17377 | - | 1140 | WP_000790641 | TrbI/VirB10 family protein | virB10 |
| SEEM0315_RS25020 (SEEM0315_025045) | 17367..18068 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| SEEM0315_RS25025 (SEEM0315_025050) | 18134..18868 | - | 735 | WP_000432283 | type IV secretion system protein | virB8 |
| SEEM0315_RS25030 (SEEM0315_025055) | 18868..19002 | - | 135 | WP_000701233 | hypothetical protein | - |
| SEEM0315_RS25035 (SEEM0315_025060) | 19034..21391 | - | 2358 | WP_023223346 | VirB4 family type IV secretion system protein | virb4 |
| SEEM0315_RS25040 (SEEM0315_025065) | 21397..21717 | - | 321 | WP_010895893 | VirB3 family type IV secretion system protein | virB3 |
| SEEM0315_RS26615 (SEEM0315_025070) | 21788..22078 | - | 291 | WP_000865478 | TrbC/VirB2 family protein | virB2 |
| SEEM0315_RS25050 (SEEM0315_025075) | 22078..22662 | - | 585 | WP_023223347 | lytic transglycosylase domain-containing protein | virB1 |
| SEEM0315_RS25055 (SEEM0315_025080) | 22683..23081 | - | 399 | WP_001153669 | hypothetical protein | - |
| SEEM0315_RS25060 (SEEM0315_025085) | 23421..23858 | - | 438 | WP_000539666 | type IV pilus biogenesis protein PilM | - |
| SEEM0315_RS25065 (SEEM0315_025090) | 23864..25099 | - | 1236 | WP_000733400 | toxin co-regulated pilus biosynthesis Q family protein | - |
| SEEM0315_RS25070 (SEEM0315_025095) | 25102..25389 | - | 288 | WP_001326593 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| SEEM0315_RS25075 (SEEM0315_025100) | 25561..26196 | - | 636 | WP_000835773 | hypothetical protein | - |
| SEEM0315_RS25080 (SEEM0315_025105) | 26269..26556 | - | 288 | WP_001032611 | EexN family lipoprotein | - |
| SEEM0315_RS25085 (SEEM0315_025110) | 26569..26823 | - | 255 | WP_001043555 | EexN family lipoprotein | - |
| SEEM0315_RS25090 (SEEM0315_025115) | 26825..27466 | - | 642 | WP_001425343 | type IV secretion system protein | - |
| SEEM0315_RS25095 (SEEM0315_025120) | 27472..28467 | - | 996 | WP_001028543 | type IV secretion system protein | virB6 |
| SEEM0315_RS25100 (SEEM0315_025125) | 28471..28728 | - | 258 | WP_000739144 | hypothetical protein | - |
| SEEM0315_RS25105 (SEEM0315_025130) | 28725..29027 | - | 303 | WP_001360345 | hypothetical protein | - |
| SEEM0315_RS25110 (SEEM0315_025135) | 29043..29294 | - | 252 | WP_235613332 | hypothetical protein | - |
| SEEM0315_RS25120 (SEEM0315_025145) | 29442..29903 | - | 462 | WP_001243166 | hypothetical protein | - |
| SEEM0315_RS26620 | 29914..30084 | - | 171 | WP_000550720 | hypothetical protein | - |
| SEEM0315_RS25125 (SEEM0315_025150) | 30088..30531 | - | 444 | WP_000964330 | NfeD family protein | - |
| SEEM0315_RS25135 (SEEM0315_025160) | 30905..31858 | - | 954 | WP_072089442 | SPFH domain-containing protein | - |
| SEEM0315_RS26625 | 31885..32061 | - | 177 | WP_000753049 | hypothetical protein | - |
| SEEM0315_RS25140 (SEEM0315_025165) | 32054..32269 | - | 216 | WP_001127357 | DUF1187 family protein | - |
| SEEM0315_RS25145 (SEEM0315_025170) | 32262..32714 | - | 453 | WP_000101552 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 3281 | GenBank | NZ_CP019199 |
| Plasmid name | pCFSAN001297_02 | Incompatibility group | IncI2 |
| Plasmid size | 59062 bp | Coordinate of oriT [Strand] | 46398..46450 [-] |
| Host baterium | Salmonella enterica subsp. enterica serovar Muenster str. 0315 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |