Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 102826 |
| Name | oriT_pCN1_1  |
| Organism | Klebsiella pneumoniae strain CN1 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP015383 (139772..139821 [-], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_pCN1_1
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTCATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTCATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 1754 | GenBank | WP_015065541 |
| Name | traD_A6U99_RS28170_pCN1_1 |
UniProt ID | _ |
| Length | 770 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 770 a.a. Molecular weight: 86025.00 Da Isoelectric Point: 5.0577
>WP_015065541.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacterales]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPEPVKAPPTIKRPAAEPSVRTTEPSVLRVTTVPLIKPKAAAAAAAASTASSSGAPATAAGGTQ
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPEPVKAPPTIKRPAAEPSVRTTEPSVLRVTTVPLIKPKAAAAAAAASTASSSGAPATAAGGTQ
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 139214..171681
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A6U99_RS27890 (A6U99_26675) | 134232..134582 | + | 351 | WP_004182068 | hypothetical protein | - |
| A6U99_RS27905 (A6U99_26685) | 135218..135574 | + | 357 | WP_004152717 | hypothetical protein | - |
| A6U99_RS27910 (A6U99_26690) | 135635..135847 | + | 213 | WP_004182070 | hypothetical protein | - |
| A6U99_RS27915 (A6U99_26695) | 135858..136082 | + | 225 | WP_004152719 | hypothetical protein | - |
| A6U99_RS27920 (A6U99_26700) | 136163..136483 | + | 321 | WP_004152720 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| A6U99_RS27925 (A6U99_26705) | 136473..136751 | + | 279 | WP_004152721 | helix-turn-helix transcriptional regulator | - |
| A6U99_RS27930 (A6U99_26710) | 136752..137165 | + | 414 | WP_004182074 | helix-turn-helix domain-containing protein | - |
| A6U99_RS27950 (A6U99_26720) | 137998..138819 | + | 822 | WP_004182076 | DUF932 domain-containing protein | - |
| A6U99_RS27955 | 138852..139181 | + | 330 | WP_011977736 | DUF5983 family protein | - |
| A6U99_RS27960 (A6U99_26725) | 139214..139699 | - | 486 | WP_004178063 | transglycosylase SLT domain-containing protein | virB1 |
| A6U99_RS27965 (A6U99_26730) | 140090..140506 | + | 417 | WP_072145360 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| A6U99_RS27970 (A6U99_26735) | 140706..141425 | + | 720 | WP_016831034 | conjugal transfer protein TrbJ | - |
| A6U99_RS27975 (A6U99_26740) | 141558..141764 | + | 207 | WP_171773970 | TraY domain-containing protein | - |
| A6U99_RS27980 (A6U99_26745) | 141826..142194 | + | 369 | WP_004194426 | type IV conjugative transfer system pilin TraA | - |
| A6U99_RS27985 (A6U99_26750) | 142208..142513 | + | 306 | WP_004144424 | type IV conjugative transfer system protein TraL | traL |
| A6U99_RS27990 (A6U99_26755) | 142533..143099 | + | 567 | WP_016831035 | type IV conjugative transfer system protein TraE | traE |
| A6U99_RS27995 (A6U99_26760) | 143086..143826 | + | 741 | WP_032408905 | type-F conjugative transfer system secretin TraK | traK |
| A6U99_RS28000 (A6U99_26765) | 143826..145250 | + | 1425 | WP_040120201 | F-type conjugal transfer pilus assembly protein TraB | traB |
| A6U99_RS28005 (A6U99_26770) | 145276..146244 | - | 969 | WP_076026135 | IS5-like element IS903B family transposase | - |
| A6U99_RS28015 (A6U99_26780) | 146309..146905 | + | 597 | Protein_163 | conjugal transfer pilus-stabilizing protein TraP | - |
| A6U99_RS28020 (A6U99_26785) | 146928..147512 | + | 585 | WP_014386196 | type IV conjugative transfer system lipoprotein TraV | traV |
| A6U99_RS28025 (A6U99_26790) | 147644..148054 | + | 411 | WP_032409654 | hypothetical protein | - |
| A6U99_RS28030 (A6U99_26795) | 148059..148348 | + | 290 | Protein_166 | hypothetical protein | - |
| A6U99_RS28035 (A6U99_26800) | 148372..148590 | + | 219 | WP_014386199 | hypothetical protein | - |
| A6U99_RS28040 (A6U99_26805) | 148591..148902 | + | 312 | WP_016831041 | hypothetical protein | - |
| A6U99_RS28045 (A6U99_26810) | 148969..149373 | + | 405 | WP_016831042 | hypothetical protein | - |
| A6U99_RS30020 | 149416..149574 | + | 159 | WP_223178560 | hypothetical protein | - |
| A6U99_RS30025 (A6U99_26815) | 149588..149806 | + | 219 | WP_072196435 | hypothetical protein | - |
| A6U99_RS28055 (A6U99_26820) | 149814..150212 | + | 399 | WP_023158008 | hypothetical protein | - |
| A6U99_RS28060 (A6U99_26825) | 150284..152923 | + | 2640 | WP_016831045 | type IV secretion system protein TraC | virb4 |
| A6U99_RS28065 (A6U99_26830) | 152923..153312 | + | 390 | WP_004167468 | type-F conjugative transfer system protein TrbI | - |
| A6U99_RS28070 (A6U99_26835) | 153312..153947 | + | 636 | WP_016831046 | type-F conjugative transfer system protein TraW | traW |
| A6U99_RS28075 (A6U99_26840) | 153982..154383 | + | 402 | WP_016831047 | hypothetical protein | - |
| A6U99_RS28080 (A6U99_26845) | 154380..155369 | + | 990 | WP_015632509 | conjugal transfer pilus assembly protein TraU | traU |
| A6U99_RS29750 | 155390..155566 | + | 177 | WP_162866177 | hypothetical protein | - |
| A6U99_RS28085 (A6U99_26850) | 155645..156292 | + | 648 | WP_039109927 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| A6U99_RS28090 (A6U99_26855) | 156351..158306 | + | 1956 | WP_023313940 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| A6U99_RS28095 (A6U99_26860) | 158338..158592 | + | 255 | WP_015065558 | conjugal transfer protein TrbE | - |
| A6U99_RS28100 (A6U99_26865) | 158570..158818 | + | 249 | WP_004152675 | hypothetical protein | - |
| A6U99_RS28105 (A6U99_26870) | 158831..159157 | + | 327 | WP_016831051 | hypothetical protein | - |
| A6U99_RS28110 (A6U99_26875) | 159178..159930 | + | 753 | WP_004152677 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| A6U99_RS28115 (A6U99_26880) | 159941..160180 | + | 240 | WP_004144400 | type-F conjugative transfer system pilin chaperone TraQ | - |
| A6U99_RS28120 (A6U99_26885) | 160152..160709 | + | 558 | WP_004152678 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| A6U99_RS28125 (A6U99_26890) | 160755..161198 | + | 444 | WP_016831053 | F-type conjugal transfer protein TrbF | - |
| A6U99_RS28130 (A6U99_26895) | 161176..162555 | + | 1380 | WP_072159542 | conjugal transfer pilus assembly protein TraH | traH |
| A6U99_RS29230 (A6U99_26900) | 162555..162737 | + | 183 | Protein_189 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
| A6U99_RS28140 (A6U99_26905) | 162769..163845 | - | 1077 | WP_000227969 | IS110 family transposase | - |
| A6U99_RS28150 (A6U99_26910) | 164127..166751 | + | 2625 | Protein_191 | conjugal transfer mating-pair stabilization protein TraG | - |
| A6U99_RS28155 | 166774..167376 | + | 603 | WP_071604857 | hypothetical protein | - |
| A6U99_RS28160 (A6U99_26915) | 167627..168358 | + | 732 | WP_016831056 | conjugal transfer complement resistance protein TraT | - |
| A6U99_RS29755 | 168551..169240 | + | 690 | WP_072198073 | hypothetical protein | - |
| A6U99_RS28170 (A6U99_26925) | 169369..171681 | + | 2313 | WP_015065541 | type IV conjugative transfer system coupling protein TraD | virb4 |
Host bacterium
| ID | 3269 | GenBank | NZ_CP015383 |
| Plasmid name | pCN1_1 | Incompatibility group | IncFIB |
| Plasmid size | 182846 bp | Coordinate of oriT [Strand] | 139772..139821 [-] |
| Host baterium | Klebsiella pneumoniae strain CN1 |
Cargo genes
| Drug resistance gene | dfrA14, qnrB1, aac(3)-IIa, blaOXA-1, aac(6')-Ib-cr, tet(A) |
| Virulence gene | - |
| Metal resistance gene | arsR, arsD, arsA, arsB, arsC, arsH, pcoE, pcoS, pcoR, pcoD, pcoC, pcoB, pcoA, silP, silA, silB, silF, silC, silR, silS, silE |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | AcrIE9 |