Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102825
Name   oriT_pKp_Goe_414-6 in_silico
Organism   Klebsiella pneumoniae isolate Kp_Goe_154414
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP018343 (25715..25800 [-], 86 nt)
oriT length   86 nt
IRs (inverted repeats)      61..68, 73..80  (TTGGTGGT..ACCACCAA)
 27..34, 37..44  (GCAAAAAC..GTTTTTGC)
 8..14, 20..26  (TGATTTA..TAAATCA)
Location of nic site      53..54
Conserved sequence flanking the
  nic site    		  TGTGTGGTGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 86 nt

>oriT_pKp_Goe_414-6
AATTACATGATTTAAAACGTAAATCAGCAAAAACTTGTTTTTGCGTAGTGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   1753 GenBank   WP_000069777
Name   traC_BB788_RS30940_pKp_Goe_414-6 insolico UniProt ID   _
Length   876 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 876 a.a.        Molecular weight: 99195.86 Da        Isoelectric Point: 6.1126

>WP_000069777.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MSNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAI
PINGANKSIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAA
ATQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASIATQTVDAQAFIDIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLNVRADYLTLGLRENGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAGSPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGW
RLLDFKNRKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKY
NQLYPDQFQPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

Family of unknown function (DUF5934) (DUF5934)

(290-447)

TraG P-loop domain (P-loop_TraG)

(468-764)

TraC protein (TraC_F_IV)

(39-277)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 25147..37797

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BB788_RS30820 (BB788_30525) 20525..20950 + 426 WP_000422741 transposase -
BB788_RS30825 (BB788_30530) 20947..21297 + 351 WP_000624722 IS66 family insertion sequence element accessory protein TnpB -
BB788_RS30830 (BB788_30535) 21328..22941 + 1614 WP_000080200 IS66-like element ISEc23 family transposase -
BB788_RS32750 (BB788_30540) 23026..23322 - 297 Protein_31 hypothetical protein -
BB788_RS30850 (BB788_30550) 23622..23918 + 297 WP_001272251 hypothetical protein -
BB788_RS30855 (BB788_30555) 24029..24850 + 822 WP_001234445 DUF932 domain-containing protein -
BB788_RS30860 (BB788_30560) 25147..25737 - 591 WP_000252683 transglycosylase SLT domain-containing protein virB1
BB788_RS30865 (BB788_30565) 26072..26455 + 384 WP_001354030 conjugal transfer relaxosome DNA-binding protein TraM -
BB788_RS30870 (BB788_30570) 26649..27320 + 672 WP_000283561 conjugal transfer transcriptional regulator TraJ -
BB788_RS30875 (BB788_30575) 27457..27684 + 228 WP_000089263 conjugal transfer relaxosome protein TraY -
BB788_RS30880 (BB788_30580) 27717..28076 + 360 WP_001098992 type IV conjugative transfer system pilin TraA -
BB788_RS30885 (BB788_30585) 28091..28402 + 312 WP_000012113 type IV conjugative transfer system protein TraL traL
BB788_RS30890 (BB788_30590) 28424..28990 + 567 WP_000399780 type IV conjugative transfer system protein TraE traE
BB788_RS30895 (BB788_30595) 28977..29705 + 729 WP_001230772 type-F conjugative transfer system secretin TraK traK
BB788_RS30900 (BB788_30600) 29705..31156 + 1452 WP_000146675 F-type conjugal transfer pilus assembly protein TraB traB
BB788_RS30905 (BB788_30605) 31146..31712 + 567 WP_000896599 conjugal transfer pilus-stabilizing protein TraP -
BB788_RS30910 (BB788_30610) 31699..32019 + 321 WP_001057307 conjugal transfer protein TrbD -
BB788_RS30915 (BB788_30615) 32016..32531 + 516 WP_000809881 type IV conjugative transfer system lipoprotein TraV traV
BB788_RS30920 (BB788_30620) 32666..32887 + 222 WP_001278683 conjugal transfer protein TraR -
BB788_RS30925 (BB788_30625) 32880..33356 + 477 WP_000549587 hypothetical protein -
BB788_RS30930 (BB788_30630) 33436..33654 + 219 WP_000556745 hypothetical protein -
BB788_RS30935 (BB788_30635) 33682..34029 + 348 WP_000836682 hypothetical protein -
BB788_RS30940 (BB788_30640) 34155..36785 + 2631 WP_000069777 type IV secretion system protein TraC virb4
BB788_RS30945 (BB788_30645) 36782..37168 + 387 WP_000214084 type-F conjugative transfer system protein TrbI -
BB788_RS30950 (BB788_30650) 37165..37797 + 633 WP_001203728 type-F conjugative transfer system protein TraW traW
BB788_RS30955 (BB788_30655) 37794..38699 + 906 Protein_53 conjugal transfer pilus assembly protein TraU -
BB788_RS30965 (BB788_30665) 38748..39445 + 698 WP_095033700 IS1-like element IS1B family transposase -
BB788_RS30970 (BB788_30670) 39478..40068 + 591 WP_000766807 DUF2726 domain-containing protein -
BB788_RS30975 (BB788_30675) 40308..40562 + 255 WP_000083830 replication regulatory protein RepA -
BB788_RS30985 (BB788_30685) 40800..40874 + 75 WP_001365705 RepA leader peptide Tap -
BB788_RS30990 (BB788_30690) 40867..41724 + 858 WP_000130646 incFII family plasmid replication initiator RepA -

Host bacterium

ID   3268 GenBank   NZ_CP018343
Plasmid name   pKp_Goe_414-6 Incompatibility group   IncFII
Plasmid size   57266 bp Coordinate of oriT [Strand]   25715..25800 [-]
Host baterium   Klebsiella pneumoniae isolate Kp_Goe_154414

Cargo genes

Drug resistance gene   blaCTX-M-55, aac(6')-Ib-cr, blaOXA-1, aac(3)-IIa
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -