Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102819
Name   oriT_pKp_Goe_208-2 in_silico
Organism   Klebsiella pneumoniae strain Kp_Goe_33208
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP018449 (42081..42185 [+], 105 nt)
oriT length   105 nt
IRs (inverted repeats)      32..37, 40..45  (GCCGGC..GCCGGC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 105 nt

>oriT_pKp_Goe_208-2
AGTACGGGACAAGATGTGTTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   2088 GenBank   WP_004206924
Name   Relaxase_BB747_RS29660_pKp_Goe_208-2 insolico UniProt ID   A0A2V4FJ40
Length   659 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75087.84 Da        Isoelectric Point: 10.0285

>WP_004206924.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFAGIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQLRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure


Source ID Structure
AlphaFold DB A0A2V4FJ40


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 44983..64179

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BB747_RS29640 (BB747_29480) 40067..40378 + 312 WP_004187333 hypothetical protein -
BB747_RS29645 (BB747_29485) 40511..41047 + 537 WP_036970776 hypothetical protein -
BB747_RS29650 (BB747_29490) 41548..41913 - 366 WP_015586046 hypothetical protein -
BB747_RS29655 (BB747_29495) 42189..42506 + 318 WP_004206923 plasmid mobilization protein MobA -
BB747_RS29660 (BB747_29500) 42493..44472 + 1980 WP_004206924 TraI/MobA(P) family conjugative relaxase -
BB747_RS29665 (BB747_29505) 44486..44986 + 501 WP_004206925 DotD/TraH family lipoprotein -
BB747_RS29670 (BB747_29510) 44983..45762 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
BB747_RS29675 (BB747_29515) 45773..46936 + 1164 WP_004206926 plasmid transfer ATPase TraJ virB11
BB747_RS29680 (BB747_29520) 46926..47186 + 261 WP_004187310 IcmT/TraK family protein traK
BB747_RS31685 47211..50516 + 3306 WP_220381329 LPD7 domain-containing protein -
BB747_RS29690 (BB747_29530) 50482..50994 + 513 WP_011091071 hypothetical protein traL
BB747_RS29695 (BB747_29535) 50995..51207 - 213 WP_305953721 Hha/YmoA family nucleoid-associated regulatory protein -
BB747_RS29700 (BB747_29540) 51179..51589 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
BB747_RS29705 (BB747_29545) 51657..52370 + 714 WP_223294958 DotI/IcmL family type IV secretion protein traM
BB747_RS29710 (BB747_29550) 52379..53530 + 1152 WP_015062843 DotH/IcmK family type IV secretion protein traN
BB747_RS29715 (BB747_29555) 53542..54891 + 1350 WP_036970781 conjugal transfer protein TraO traO
BB747_RS29720 (BB747_29560) 54903..55607 + 705 WP_004206933 conjugal transfer protein TraP traP
BB747_RS29725 (BB747_29565) 55631..56161 + 531 WP_004187478 conjugal transfer protein TraQ traQ
BB747_RS29730 (BB747_29570) 56178..56567 + 390 WP_011154472 DUF6750 family protein traR
BB747_RS29735 (BB747_29575) 56613..57107 + 495 WP_004187480 hypothetical protein -
BB747_RS29740 (BB747_29580) 57104..60154 + 3051 WP_011154474 conjugative transfer protein traU
BB747_RS29745 (BB747_29585) 60151..61359 + 1209 WP_004187486 conjugal transfer protein TraW traW
BB747_RS29750 (BB747_29590) 61356..62006 + 651 WP_004187488 hypothetical protein -
BB747_RS29755 (BB747_29595) 61999..64179 + 2181 WP_004187492 DotA/TraY family protein traY
BB747_RS29760 (BB747_29600) 64182..64835 + 654 WP_004206935 hypothetical protein -
BB747_RS29765 (BB747_29605) 64909..65139 + 231 WP_004187496 IncL/M type plasmid replication protein RepC -
BB747_RS29770 (BB747_29610) 65436..66491 + 1056 WP_021526650 plasmid replication initiator RepA -

Host bacterium

ID   3262 GenBank   NZ_CP018449
Plasmid name   pKp_Goe_208-2 Incompatibility group   IncL/M
Plasmid size   67101 bp Coordinate of oriT [Strand]   42081..42185 [+]
Host baterium   Klebsiella pneumoniae strain Kp_Goe_33208

Cargo genes

Drug resistance gene   blaOXA-48, blaCTX-M-14b, aph(3'')-Ib, aph(3')-VIb
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -