Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 102799 |
| Name | oriT_paadD  |
| Organism | Staphylococcus aureus strain LA-MRSA ST398 isolate E154 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP014695 (5359..5399 [-], 41 nt) |
| oriT length | 41 nt |
| IRs (inverted repeats) | 2..8, 13..19 (ACTTTAT..ATAAAGT) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 41 nt
>oriT_paadD
CACTTTATGAATATAAAGTATAATGTGTTATACTTTACATG
CACTTTATGAATATAAAGTATAATGTGTTATACTTTACATG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 2072 | GenBank | WP_071938212 |
| Name | Mob_Pre_AS852_RS14740_paadD |
UniProt ID | _ |
| Length | 71 a.a. | PDB ID | |
| Note | Predicted by oriTfinder 2.0 | ||
Relaxase protein sequence
Download Length: 71 a.a. Molecular weight: 8196.26 Da Isoelectric Point: 10.0468
>WP_071938212.1 plasmid recombination protein [Staphylococcus aureus]
MSMIVARMQKMKAENLVGIGNHNQRKTKNHSNPDIDTSLSKLNYDLVDRTQNYKTDIENFINENKTTTRA
V
MSMIVARMQKMKAENLVGIGNHNQRKTKNHSNPDIDTSLSKLNYDLVDRTQNYKTDIENFINENKTTTRA
V
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
Host bacterium
| ID | 3242 | GenBank | NZ_CP014695 |
| Plasmid name | paadD | Incompatibility group | - |
| Plasmid size | 7190 bp | Coordinate of oriT [Strand] | 5359..5399 [-] |
| Host baterium | Staphylococcus aureus strain LA-MRSA ST398 isolate E154 |
Cargo genes
| Drug resistance gene | aadD |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |