Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   102767
Name   oriT_pIncFIB_DHQP1300920 in_silico
Organism   Klebsiella pneumoniae isolate 11
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP016922 (26002..26051 [+], 50 nt)
oriT length   50 nt
IRs (inverted repeats)      7..14, 17..24  (GCAAAATT..AATTTTGC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 50 nt

>oriT_pIncFIB_DHQP1300920
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTCATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1694 GenBank   WP_043907039
Name   traD_A8C11_RS02360_pIncFIB_DHQP1300920 insolico UniProt ID   _
Length   770 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 770 a.a.        Molecular weight: 85906.85 Da        Isoelectric Point: 5.0577

>WP_043907039.1 type IV conjugative transfer system coupling protein TraD [Klebsiella pneumoniae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFAFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPEPVKAPPTIKRPAAEPSVRTTEPSVLRVTTVPLIKPKAAAAAAAASTASSSGAPATAAGGTQ
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF

  Protein domains


Predicted by InterproScan.

(32-128)

(172-560)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 5092..26609

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A8C11_RS01865 (A8C11_01865) 905..1453 - 549 WP_004152623 conjugal transfer entry exclusion protein TraS -
A8C11_RS01870 (A8C11_01870) 1466..2455 - 990 Protein_2 conjugal transfer protein TraG -
A8C11_RS01875 (A8C11_01875) 2513..3210 + 698 WP_223174630 IS1 family transposase -
A8C11_RS01880 (A8C11_01880) 3239..5092 - 1854 Protein_4 conjugal transfer mating-pair stabilization protein TraG -
A8C11_RS01885 (A8C11_01885) 5092..6471 - 1380 WP_011977731 conjugal transfer pilus assembly protein TraH traH
A8C11_RS01890 (A8C11_01890) 6449..6892 - 444 WP_030003485 F-type conjugal transfer protein TrbF -
A8C11_RS01895 (A8C11_01895) 6938..7495 - 558 WP_013214031 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
A8C11_RS01900 (A8C11_01900) 7467..7706 - 240 WP_004144400 type-F conjugative transfer system pilin chaperone TraQ -
A8C11_RS01905 (A8C11_01905) 7717..8469 - 753 WP_004152677 type-F conjugative transfer system pilin assembly protein TraF traF
A8C11_RS01910 (A8C11_01910) 8490..8816 - 327 WP_013214030 hypothetical protein -
A8C11_RS01915 (A8C11_01915) 8829..9077 - 249 WP_013214029 hypothetical protein -
A8C11_RS01920 (A8C11_01920) 9055..9309 - 255 WP_004152674 conjugal transfer protein TrbE -
A8C11_RS01925 (A8C11_01925) 9341..11296 - 1956 WP_040145764 type-F conjugative transfer system mating-pair stabilization protein TraN traN
A8C11_RS01930 (A8C11_01930) 11344..11982 - 639 WP_004152682 type-F conjugative transfer system pilin assembly protein TrbC trbC
A8C11_RS01935 (A8C11_01935) 11995..12954 - 960 WP_015065634 conjugal transfer pilus assembly protein TraU traU
A8C11_RS30775 (A8C11_01940) 12998..13624 - 627 WP_004152590 type-F conjugative transfer system protein TraW traW
A8C11_RS30780 (A8C11_01945) 13624..14002 - 379 Protein_17 type-F conjugative transfer system protein TrbI -
A8C11_RS01950 (A8C11_01950) 14002..16641 - 2640 WP_004152592 type IV secretion system protein TraC virb4
A8C11_RS01955 (A8C11_01955) 16713..17111 - 399 WP_004153071 hypothetical protein -
A8C11_RS01960 (A8C11_01960) 17407..17811 - 405 WP_004152594 hypothetical protein -
A8C11_RS01965 (A8C11_01965) 17878..18195 - 318 WP_004152595 hypothetical protein -
A8C11_RS01970 (A8C11_01970) 18196..18414 - 219 WP_004171484 hypothetical protein -
A8C11_RS01975 (A8C11_01975) 18438..18728 - 291 WP_004152596 hypothetical protein -
A8C11_RS01980 (A8C11_01980) 18733..19143 - 411 WP_004152597 lipase chaperone -
A8C11_RS01985 (A8C11_01985) 19275..19844 - 570 WP_004152598 type IV conjugative transfer system lipoprotein TraV traV
A8C11_RS01990 (A8C11_01990) 19867..20463 - 597 WP_004152599 conjugal transfer pilus-stabilizing protein TraP -
A8C11_RS01995 (A8C11_01995) 20456..21880 - 1425 WP_004152600 F-type conjugal transfer pilus assembly protein TraB traB
A8C11_RS02000 (A8C11_02000) 21880..22620 - 741 WP_004152601 type-F conjugative transfer system secretin TraK traK
A8C11_RS02005 (A8C11_02005) 22607..23173 - 567 WP_004152602 type IV conjugative transfer system protein TraE traE
A8C11_RS02010 (A8C11_02010) 23193..23498 - 306 WP_004144424 type IV conjugative transfer system protein TraL traL
A8C11_RS02015 (A8C11_02015) 23512..23880 - 369 WP_004152496 type IV conjugative transfer system pilin TraA -
A8C11_RS02020 (A8C11_02020) 23934..24305 - 372 WP_004208838 TraY domain-containing protein -
A8C11_RS28930 24389..25084 - 696 WP_004178061 transcriptional regulator TraJ family protein -
A8C11_RS02030 (A8C11_02030) 25298..25690 - 393 WP_004178062 conjugal transfer relaxosome DNA-binding protein TraM -
A8C11_RS02035 (A8C11_02035) 26124..26609 + 486 WP_004178063 transglycosylase SLT domain-containing protein virB1
A8C11_RS28935 26642..26971 - 330 WP_011977736 DUF5983 family protein -
A8C11_RS02040 (A8C11_02040) 27004..27825 - 822 WP_004178064 DUF932 domain-containing protein -
A8C11_RS02055 (A8C11_02055) 28659..29072 - 414 WP_004152722 helix-turn-helix domain-containing protein -
A8C11_RS02060 (A8C11_02060) 29073..29351 - 279 WP_004152721 helix-turn-helix transcriptional regulator -
A8C11_RS02065 (A8C11_02065) 29341..29661 - 321 WP_004152720 type II toxin-antitoxin system RelE/ParE family toxin -
A8C11_RS02070 (A8C11_02070) 29742..29966 - 225 WP_004152719 hypothetical protein -
A8C11_RS02075 (A8C11_02075) 29977..30189 - 213 WP_004152718 hypothetical protein -
A8C11_RS02080 (A8C11_02080) 30250..30606 - 357 WP_004152717 hypothetical protein -
A8C11_RS02085 (A8C11_02085) 31242..31592 - 351 WP_004152758 hypothetical protein -


Host bacterium


ID   3210 GenBank   NZ_CP016922
Plasmid name   pIncFIB_DHQP1300920 Incompatibility group   IncFIB
Plasmid size   103694 bp Coordinate of oriT [Strand]   26002..26051 [+]
Host baterium   Klebsiella pneumoniae isolate 11

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIE9