Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102747
Name   oriT_blood sample 2|2 in_silico
Organism   Klebsiella pneumoniae isolate blood sample
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP015824 (100913..100962 [-], 50 nt)
oriT length   50 nt
IRs (inverted repeats)      7..14, 17..24  (GCAAAATT..AATTTTGC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 50 nt

>oriT_blood sample 2|2
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTCATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   1672 GenBank   WP_032495268
Name   traD_A8N26_RS28825_blood sample 2|2 insolico UniProt ID   _
Length   770 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 770 a.a.        Molecular weight: 85986.98 Da        Isoelectric Point: 5.0632

>WP_032495268.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFAFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKITEGFIPRRLDTRVDARLSALLEAREAEGSLARALFTPDTPEPGPADTDSHASEQPEPVSPPA
PAVMTVTPAPVKSPPTTKRPAAEPSVRATEPPVLRGTTVPLIKPKAAAAATAASTASSAGAPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(172-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 1110..26719

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A8N26_RS30940 97..1077 - 981 Protein_0 IS5-like element ISKpn26 family transposase -
A8N26_RS28680 (A8N26_28670) 1110..1691 + 582 WP_040180858 type IV conjugative transfer system protein TraE traE
A8N26_RS28685 (A8N26_28675) 1678..2411 + 734 Protein_2 type-F conjugative transfer system secretin TraK -
A8N26_RS32665 (A8N26_28680) 2411..3832 + 1422 Protein_3 F-type conjugal transfer pilus assembly protein TraB -
A8N26_RS28700 (A8N26_28690) 3946..4529 + 584 Protein_4 type IV conjugative transfer system lipoprotein TraV -
A8N26_RS28705 (A8N26_28695) 4661..5071 + 411 WP_004152499 hypothetical protein -
A8N26_RS30950 5177..5395 + 219 WP_004152501 hypothetical protein -
A8N26_RS28710 (A8N26_28700) 5396..5707 + 312 WP_004152502 hypothetical protein -
A8N26_RS28715 (A8N26_28705) 5774..6178 + 405 WP_004152503 hypothetical protein -
A8N26_RS32990 6367..6609 + 243 WP_004158946 hypothetical protein -
A8N26_RS28725 (A8N26_28715) 6617..7015 + 399 WP_011977783 hypothetical protein -
A8N26_RS28730 (A8N26_28720) 7087..9726 + 2640 WP_004152505 type IV secretion system protein TraC virb4
A8N26_RS28735 (A8N26_28725) 9726..10115 + 390 WP_004152506 type-F conjugative transfer system protein TrbI -
A8N26_RS28740 (A8N26_28730) 10115..10741 + 627 WP_004152507 type-F conjugative transfer system protein TraW traW
A8N26_RS28745 (A8N26_28735) 10783..11172 + 390 WP_004152508 hypothetical protein -
A8N26_RS28750 (A8N26_28740) 11169..12158 + 990 WP_011977785 conjugal transfer pilus assembly protein TraU traU
A8N26_RS28755 (A8N26_28745) 12171..12809 + 639 WP_004152672 type-F conjugative transfer system pilin assembly protein TrbC trbC
A8N26_RS28760 (A8N26_28750) 12868..14823 + 1956 WP_004152673 type-F conjugative transfer system mating-pair stabilization protein TraN traN
A8N26_RS28765 (A8N26_28755) 14855..15109 + 255 WP_004152674 conjugal transfer protein TrbE -
A8N26_RS28770 (A8N26_28760) 15087..15335 + 249 WP_004152675 hypothetical protein -
A8N26_RS28775 (A8N26_28765) 15348..15674 + 327 WP_004152676 hypothetical protein -
A8N26_RS28780 (A8N26_28770) 15695..16447 + 753 WP_004152677 type-F conjugative transfer system pilin assembly protein TraF traF
A8N26_RS28785 (A8N26_28775) 16458..16697 + 240 WP_004144400 type-F conjugative transfer system pilin chaperone TraQ -
A8N26_RS28790 (A8N26_28780) 16669..17226 + 558 WP_004152678 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
A8N26_RS28795 (A8N26_28785) 17272..17715 + 444 WP_004152679 F-type conjugal transfer protein TrbF -
A8N26_RS28800 (A8N26_28790) 17693..19072 + 1380 WP_004165169 conjugal transfer pilus assembly protein TraH traH
A8N26_RS28805 (A8N26_28795) 19072..21921 + 2850 WP_004152624 conjugal transfer mating-pair stabilization protein TraG traG
A8N26_RS28810 (A8N26_28800) 21934..22482 + 549 WP_004152623 conjugal transfer entry exclusion protein TraS -
A8N26_RS28815 (A8N26_28805) 22666..23397 + 732 WP_004152622 conjugal transfer complement resistance protein TraT -
A8N26_RS32670 23589..24278 + 690 WP_004198206 hypothetical protein -
A8N26_RS28825 (A8N26_28815) 24407..26719 + 2313 WP_032495268 type IV conjugative transfer system coupling protein TraD virb4

Host bacterium

ID   3190 GenBank   NZ_CP015824
Plasmid name   blood sample 2|2 Incompatibility group   IncFII
Plasmid size   103147 bp Coordinate of oriT [Strand]   100913..100962 [-]
Host baterium   Klebsiella pneumoniae isolate blood sample

Cargo genes

Drug resistance gene   blaKPC-3
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIE9