Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   102730
Name   oriT_O177:H21|unnamed1 in_silico
Organism   Escherichia coli strain O177:H21
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP016547 (56178..56231 [-], 54 nt)
oriT length   54 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 54 nt

>oriT_O177:H21|unnamed1
CACAAGCATTGTAACATGCCCGGAACGGGCTTGTGTACAAAGCTTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1657 GenBank   WP_236927839
Name   t4cp2_BB405_RS26025_O177:H21|unnamed1 insolico UniProt ID   _
Length   547 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 547 a.a.        Molecular weight: 61853.05 Da        Isoelectric Point: 8.7287

>WP_236927839.1 type IV secretory system conjugative DNA transfer family protein [Escherichia coli]
MDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQFIYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSM
VILDIKLENWFLSAGFRQKELGQECFLFAPAGYAETIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKI
AAILIPASDDPIWSDSARNLFVGLGLYLLDKERFHLEQKTKGHNVPDVLVSISAILKTSVPDGGKDLAAW
MGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIETNFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSI
YLGLTPDALITHEKIVNLFFSLLVNENCRELPEHNPDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNL
RFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLYYPPKSKNALAKKISEEIGVRDMKISKRSISSGGGK
GGGSRTRNDDVIERPVLLPEEIVSLRDKKNKARNIAIREIITSEFSRPFIANKIIWFEEPEFKRRVDIAR
NNPVEIPLLFKDKTELMNKIARDAEIYLSDQKKVMVAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(22-486)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 15548..36130

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BB405_RS25980 (BB405_25980) 11433..12647 - 1215 WP_236927835 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
BB405_RS25985 (BB405_25985) 12660..13295 - 636 WP_000934977 A24 family peptidase -
BB405_RS25990 (BB405_25990) 13299..13726 - 428 Protein_18 lytic transglycosylase domain-containing protein -
BB405_RS25995 (BB405_25995) 13846..14403 - 558 WP_000095048 type 4 pilus major pilin -
BB405_RS26000 (BB405_26000) 14448..15557 - 1110 WP_000974903 type II secretion system F family protein -
BB405_RS26005 (BB405_26005) 15548..17086 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
BB405_RS26010 (BB405_26010) 17111..17605 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
BB405_RS26015 (BB405_26015) 17589..18899 - 1311 WP_001454111 type 4b pilus protein PilO2 -
BB405_RS26020 (BB405_26020) 18950..20592 - 1643 Protein_24 PilN family type IVB pilus formation outer membrane protein -
BB405_RS26025 (BB405_26025) 20643..22286 - 1644 WP_236927839 type IV secretory system conjugative DNA transfer family protein -
BB405_RS26030 (BB405_26030) 22616..23671 - 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
BB405_RS26035 (BB405_26035) 23690..24829 - 1140 WP_000790641 TrbI/VirB10 family protein virB10
BB405_RS26040 (BB405_26040) 24819..25520 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
BB405_RS26045 (BB405_26045) 25586..26320 - 735 WP_000432283 type IV secretion system protein virB8
BB405_RS26055 (BB405_26055) 26486..28843 - 2358 WP_000548950 VirB4 family type IV secretion system protein virb4
BB405_RS26060 (BB405_26060) 28849..29169 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
BB405_RS33175 (BB405_26065) 29240..29530 - 291 WP_000865479 conjugal transfer protein -
BB405_RS26070 (BB405_26070) 29530..30114 - 585 WP_001177114 lytic transglycosylase domain-containing protein virB1
BB405_RS26075 (BB405_26075) 30135..30533 - 399 WP_001153668 hypothetical protein -
BB405_RS26080 (BB405_26080) 30652..31089 - 438 WP_000539665 type IV pilus biogenesis protein PilM -
BB405_RS26085 (BB405_26085) 31095..32330 - 1236 WP_021580486 TcpQ domain-containing protein -
BB405_RS26090 (BB405_26090) 32333..32632 - 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
BB405_RS26095 (BB405_26095) 32699..33334 - 636 WP_000835765 hypothetical protein -
BB405_RS26100 (BB405_26100) 33415..34173 + 759 WP_224482110 DUF5710 domain-containing protein -
BB405_RS26105 (BB405_26105) 34251..34487 - 237 WP_000750964 EexN family lipoprotein -
BB405_RS26110 (BB405_26110) 34491..35138 - 648 WP_000653673 type IV secretion system protein -
BB405_RS26115 (BB405_26115) 35144..36130 - 987 WP_001028544 type IV secretion system protein virB6
BB405_RS26120 (BB405_26120) 36134..36391 - 258 WP_000739144 hypothetical protein -
BB405_RS26125 (BB405_26125) 36670..36927 - 258 WP_000285945 hypothetical protein -
BB405_RS26130 (BB405_26130) 36960..37406 - 447 WP_001243164 hypothetical protein -
BB405_RS32480 37417..37587 - 171 WP_000550720 hypothetical protein -
BB405_RS30095 37591..38034 - 444 WP_000964331 NfeD family protein -
BB405_RS26140 (BB405_26140) 38408..39361 - 954 WP_072089442 SPFH domain-containing protein -
BB405_RS26145 (BB405_26145) 39407..39601 - 195 WP_001127356 DUF1187 family protein -
BB405_RS26150 (BB405_26150) 39594..40046 - 453 WP_000101552 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   3173 GenBank   NZ_CP016547
Plasmid name   O177:H21|unnamed1 Incompatibility group   IncI2
Plasmid size   86371 bp Coordinate of oriT [Strand]   56178..56231 [-]
Host baterium   Escherichia coli strain O177:H21

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -