Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   102725
Name   oriT_pSLy1 in_silico
Organism   Escherichia coli strain 210205630 isolate 210205630
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP015913 (21164..21216 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pSLy1
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1652 GenBank   WP_065304450
Name   t4cp2_A9C00_RS25140_pSLy1 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73526.12 Da        Isoelectric Point: 9.2491

>WP_065304450.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNPVEIPLLFKDKTELMNKIARDAEIYLSDQKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 43850..61187

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A9C00_RS31515 38923..39054 + 132 WP_255639686 hypothetical protein -
A9C00_RS25080 (A9C00_25080) 40004..40408 - 405 WP_001175008 IS200/IS605 family transposase -
A9C00_RS25085 (A9C00_25085) 40467..41693 + 1227 WP_001672025 RNA-guided endonuclease TnpB family protein -
A9C00_RS31655 41741..41905 - 165 Protein_50 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
A9C00_RS25090 (A9C00_25090) 41924..43198 - 1275 WP_235883108 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
A9C00_RS25095 (A9C00_25095) 43211..43846 - 636 WP_000934979 A24 family peptidase -
A9C00_RS25100 (A9C00_25100) 43850..44332 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
A9C00_RS25105 (A9C00_25105) 44398..44955 - 558 WP_000095048 type 4 pilus major pilin -
A9C00_RS25110 (A9C00_25110) 45000..46109 - 1110 WP_000974903 type II secretion system F family protein -
A9C00_RS25115 (A9C00_25115) 46100..47638 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
A9C00_RS25120 (A9C00_25120) 47663..48157 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
A9C00_RS25125 (A9C00_25125) 48141..49451 - 1311 WP_001454111 type 4b pilus protein PilO2 -
A9C00_RS25130 (A9C00_25130) 49502..51145 - 1644 WP_001035587 PilN family type IVB pilus formation outer membrane protein -
A9C00_RS25135 (A9C00_25135) 51138..51668 - 531 WP_001220542 sigma 54-interacting transcriptional regulator virb4
A9C00_RS25140 (A9C00_25140) 51715..53673 - 1959 WP_065304450 type IV secretory system conjugative DNA transfer family protein -
A9C00_RS25145 (A9C00_25145) 53689..54744 - 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
A9C00_RS25150 (A9C00_25150) 54763..55902 - 1140 WP_054173905 TrbI/VirB10 family protein virB10
A9C00_RS25155 (A9C00_25155) 55892..56593 - 702 WP_049824867 TrbG/VirB9 family P-type conjugative transfer protein -
A9C00_RS25160 (A9C00_25160) 56659..57393 - 735 WP_000432282 type IV secretion system protein virB8
A9C00_RS25170 (A9C00_25170) 57559..59916 - 2358 WP_065304451 VirB4 family type IV secretion system protein virb4
A9C00_RS25175 (A9C00_25175) 59922..60242 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
A9C00_RS31410 (A9C00_25180) 60313..60603 - 291 WP_000865479 conjugal transfer protein -
A9C00_RS25185 (A9C00_25185) 60603..61187 - 585 WP_001177114 lytic transglycosylase domain-containing protein virB1
A9C00_RS25190 (A9C00_25190) 61208..61606 - 399 WP_001153665 hypothetical protein -
A9C00_RS25195 (A9C00_25195) 61725..62162 - 438 WP_000539665 type IV pilus biogenesis protein PilM -
A9C00_RS25200 (A9C00_25200) 62168..63403 - 1236 WP_015059538 TcpQ domain-containing protein -
A9C00_RS25205 (A9C00_25205) 63406..63705 - 300 WP_000835764 TrbM/KikA/MpfK family conjugal transfer protein -
A9C00_RS25210 (A9C00_25210) 63773..64054 - 282 WP_000638823 type II toxin-antitoxin system RelE/ParE family toxin -
A9C00_RS25215 (A9C00_25215) 64044..64295 - 252 WP_000121741 hypothetical protein -
A9C00_RS25220 (A9C00_25220) 64395..65030 - 636 WP_015059536 hypothetical protein -
A9C00_RS25225 (A9C00_25225) 65174..65887 + 714 WP_065304452 DUF5710 domain-containing protein -


Host bacterium


ID   3168 GenBank   NZ_CP015913
Plasmid name   pSLy1 Incompatibility group   IncI2
Plasmid size   65888 bp Coordinate of oriT [Strand]   21164..21216 [-]
Host baterium   Escherichia coli strain 210205630 isolate 210205630

Cargo genes


Drug resistance gene   mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -