Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102711
Name   oriT_pNCCP14558 in_silico
Organism   Staphylococcus aureus strain NCCP14558 isolate sequencing
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP013954 (18491..18730 [+], 240 nt)
oriT length   240 nt
IRs (inverted repeats)      217..222, 232..237  (ATTTTA..TAAAAT)
 171..178, 183..190  (CTATCATT..AATGATAG)
 155..160, 164..169  (TCTGGC..GCCAGA)
 26..32, 44..50  (TTTTTTA..TAAAAAA)
 1..7, 20..26  (AAGACAT..ATGTCTT)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 240 nt

>oriT_pNCCP14558
AAGACATTAGTGATAACTGATGTCTTTTTTTATTGTTTTTCTGTAAAAAAGTGCTGTCTTATTTTTGTGACAAATGCTGTATGTAGTGTCACACTTTTGTGACACTACAGCTTTGTATGATATCACTTTAAAATAACTTAAAACCCTTGGAATGTCTGGCCTTGCCAGATCTATCATTTTTGAATGATAGCAAATTTCCCTTATGCTCTTACGGAGATTTTAGAGTTAAATTAAAATTTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   1994 GenBank   WP_250636758
Name   Mob_Pre_ASL16_RS16470_pNCCP14558 insolico UniProt ID   _
Length   32 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 32 a.a.        Molecular weight: 3896.47 Da        Isoelectric Point: 6.1757

>WP_250636758.1 hypothetical protein [Staphylococcus aureus]
MDLSKSYLNYDLVNDTKFDFNKKIDEKIEKKL

  Protein domains



No domain identified.



  Protein structure



No available structure.




Host bacterium

ID   3154 GenBank   NZ_CP013954
Plasmid name   pNCCP14558 Incompatibility group   -
Plasmid size   24729 bp Coordinate of oriT [Strand]   18491..18730 [+]
Host baterium   Staphylococcus aureus strain NCCP14558 isolate sequencing

Cargo genes

Drug resistance gene   blaZ
Virulence gene   -
Metal resistance gene   arsR, arsC
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA21