Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102692
Name   oriT_FWSEC0121|unnamed3 in_silico
Organism   Escherichia coli strain FWSEC0121
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_RRGM01000185 (31455..31540 [+], 86 nt)
oriT length   86 nt
IRs (inverted repeats)      61..68, 73..80  (TTGGTGGT..ACCACCAA)
 27..34, 37..44  (GCAAAAAC..GTTTTTGC)
Location of nic site      53..54
Conserved sequence flanking the
  nic site    		  GGTGTAGTGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 86 nt

>oriT_FWSEC0121|unnamed3
AACTACTTATTTGCAAAGAAAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTAGTGCTTTTGGTGGTGAGAACCACCAACCTGTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   1626 GenBank   WP_136787934
Name   traD_C9Z71_RS26930_FWSEC0121|unnamed3 insolico UniProt ID   _
Length   735 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 735 a.a.        Molecular weight: 83785.48 Da        Isoelectric Point: 5.2437

>WP_136787934.1 type IV conjugative transfer system coupling protein TraD [Escherichia coli]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIRSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLASVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVSTGKSEVIRRLANYAR
KRGDMVVIYDRSCEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNVANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTYLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHSGESFTIRDWMRGVREDKQNGWLFISSNADTHASLKPVVSMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVLNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKEMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQARPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPEVASREDVTQAEQPQQPQQPQQPQQ
PQQPQQPQQPQQPVSPAINDKKSDSGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMTAYEAWQ
QENHPDIQQQMQRREEVNINVHRERGEDVEPGDDF

  Protein domains


Predicted by InterproScan.

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(173-560)

F sex factor protein N terminal (TraD_N)

(32-128)

  Protein structure



No available structure.



ID   1627 GenBank   WP_086218409
Name   traC_C9Z71_RS27060_FWSEC0121|unnamed3 insolico UniProt ID   _
Length   876 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 876 a.a.        Molecular weight: 99256.97 Da        Isoelectric Point: 6.0802

>WP_086218409.1 type IV secretion system protein TraC [Escherichia coli]
MSNNPLEVVTQAVNSLLTALKLPDESAQANQTLGEMNFPQFSRLLPYRDYNQESGLFMNDSTMGFMLEAI
PINGANKSIAEALDHMLRTKLPRGIPLCIHLMSSQLVGERIEYGLREFSWSGEQAERFNAITRAYYMKAA
ETLFPLPEGVNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQGILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGW
RLLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKY
NQLFPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

Family of unknown function (DUF5934) (DUF5934)

(290-447)

TraC protein (TraC_F_IV)

(39-277)

TraG P-loop domain (P-loop_TraG)

(468-771)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 627..32108

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C9Z71_RS26925 (C9Z71_26985) 79..627 - 549 Protein_0 MobF family relaxase -
C9Z71_RS26930 (C9Z71_26990) 627..2834 - 2208 WP_136787934 type IV conjugative transfer system coupling protein TraD virb4
C9Z71_RS26935 (C9Z71_26995) 2890..3621 - 732 WP_033802128 hypothetical protein -
C9Z71_RS26940 (C9Z71_27000) 3789..4049 - 261 WP_001077900 hypothetical protein -
C9Z71_RS26945 (C9Z71_27005) 4109..4840 - 732 WP_033814940 conjugal transfer complement resistance protein TraT -
C9Z71_RS26950 (C9Z71_27010) 4872..5369 - 498 WP_086218417 entry exclusion protein -
C9Z71_RS26955 (C9Z71_27015) 5385..8207 - 2823 WP_086218397 conjugal transfer mating-pair stabilization protein TraG traG
C9Z71_RS26960 (C9Z71_27020) 8204..9577 - 1374 WP_086218398 conjugal transfer pilus assembly protein TraH traH
C9Z71_RS26965 (C9Z71_27025) 9564..9956 - 393 WP_236118940 F-type conjugal transfer protein TrbF -
C9Z71_RS26970 (C9Z71_27030) 9910..10284 - 375 WP_086218400 P-type conjugative transfer protein TrbJ -
C9Z71_RS26975 (C9Z71_27035) 10214..10759 - 546 WP_001457363 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
C9Z71_RS26980 (C9Z71_27040) 10746..11036 - 291 WP_021521297 type-F conjugative transfer system pilin chaperone TraQ -
C9Z71_RS26990 (C9Z71_27050) 11432..11773 - 342 WP_021521299 conjugal transfer protein TrbA -
C9Z71_RS26995 (C9Z71_27055) 11787..12530 - 744 WP_063113355 type-F conjugative transfer system pilin assembly protein TraF traF
C9Z71_RS27000 (C9Z71_27060) 12523..12780 - 258 WP_021521300 conjugal transfer protein TrbE -
C9Z71_RS27005 (C9Z71_27065) 12794..14698 - 1905 WP_249535716 type-F conjugative transfer system mating-pair stabilization protein TraN traN
C9Z71_RS27010 (C9Z71_27070) 14792..15172 - 381 WP_044192461 hypothetical protein -
C9Z71_RS27015 (C9Z71_27075) 15169..15807 - 639 WP_001035184 type-F conjugative transfer system pilin assembly protein TrbC trbC
C9Z71_RS27020 (C9Z71_27080) 16036..16368 - 333 WP_086218401 hypothetical protein -
C9Z71_RS27025 (C9Z71_27085) 16395..16547 - 153 Protein_19 TraU family protein -
C9Z71_RS27030 (C9Z71_27090) 16559..17029 - 471 WP_249535717 hypothetical protein -
C9Z71_RS27040 (C9Z71_27100) 17757..18299 - 543 WP_086218405 hypothetical protein -
C9Z71_RS27045 (C9Z71_27105) 18313..19305 - 993 WP_086218406 conjugal transfer pilus assembly protein TraU traU
C9Z71_RS27050 (C9Z71_27110) 19302..19934 - 633 WP_086218407 type-F conjugative transfer system protein TraW traW
C9Z71_RS27055 (C9Z71_27115) 19931..20317 - 387 WP_086218408 type-F conjugative transfer system protein TrbI -
C9Z71_RS27060 (C9Z71_27120) 20314..22944 - 2631 WP_086218409 type IV secretion system protein TraC virb4
C9Z71_RS27065 (C9Z71_27125) 23075..23422 - 348 WP_086218410 hypothetical protein -
C9Z71_RS27070 (C9Z71_27130) 23453..23668 - 216 WP_044809101 hypothetical protein -
C9Z71_RS27075 (C9Z71_27135) 23748..24222 - 475 Protein_28 hypothetical protein -
C9Z71_RS27080 (C9Z71_27140) 24215..24436 - 222 WP_001278688 conjugal transfer protein TraR -
C9Z71_RS27085 (C9Z71_27145) 24571..25086 - 516 WP_086218411 type IV conjugative transfer system lipoprotein TraV traV
C9Z71_RS27090 (C9Z71_27150) 25083..25404 - 322 Protein_31 conjugal transfer protein TrbD -
C9Z71_RS27095 (C9Z71_27155) 25391..25978 - 588 WP_086218412 conjugal transfer pilus-stabilizing protein TraP -
C9Z71_RS27100 (C9Z71_27160) 25968..27398 - 1431 WP_086218413 F-type conjugal transfer pilus assembly protein TraB traB
C9Z71_RS27105 (C9Z71_27165) 27398..28126 - 729 WP_001365587 type-F conjugative transfer system secretin TraK traK
C9Z71_RS27110 (C9Z71_27170) 28113..28679 - 567 WP_000399759 type IV conjugative transfer system protein TraE traE
C9Z71_RS27115 (C9Z71_27175) 28701..29012 - 312 WP_000012108 type IV conjugative transfer system protein TraL traL
C9Z71_RS27120 (C9Z71_27180) 29027..29380 - 354 WP_021521309 type IV conjugative transfer system pilin TraA -
C9Z71_RS27125 (C9Z71_27185) 29436..29810 - 375 WP_053265379 conjugal transfer relaxosome DNA-bindin protein TraY -
C9Z71_RS27130 (C9Z71_27190) 29909..30598 - 690 WP_086218414 conjugal transfer transcriptional regulator TraJ -
C9Z71_RS27135 (C9Z71_27195) 30783..31166 - 384 WP_032210979 conjugal transfer relaxosome DNA-binding protein TraM -
C9Z71_RS27140 (C9Z71_27200) 31518..32108 + 591 WP_283666656 transglycosylase SLT domain-containing protein virB1
C9Z71_RS27145 (C9Z71_27205) 32404..33225 - 822 WP_001491574 DUF932 domain-containing protein -
C9Z71_RS27150 (C9Z71_27210) 33346..33633 - 288 WP_021521313 hypothetical protein -
C9Z71_RS27160 (C9Z71_27220) 33789..34091 - 303 WP_001272235 hypothetical protein -
C9Z71_RS28770 34115..34306 - 192 WP_250206790 single-stranded DNA-binding protein -

Host bacterium

ID   3135 GenBank   NZ_RRGM01000185
Plasmid name   FWSEC0121|unnamed3 Incompatibility group   -
Plasmid size   34306 bp Coordinate of oriT [Strand]   31455..31540 [+]
Host baterium   Escherichia coli strain FWSEC0121

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -