Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102686
Name   oriT_p31HGR-CBG in_silico
Organism   Escherichia coli strain 31HGR-CBG
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP080646 (99625..99976 [+], 352 nt)
oriT length   352 nt
IRs (inverted repeats)      255..262, 271..278  (ACCGCTAG..CTAGCGGT)
 192..198, 206..212  (TATAAAA..TTTTATA)
 40..47, 50..57  (GCAAAAAC..GTTTTTGC)
 4..11, 16..23  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 352 nt

>oriT_p31HGR-CBG
AGGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTTTCTTTATAAATAGAGAGTTATGAAAAATTAGTTTCTCTTACTCTCTTTATGATATTTAAAAAAGCGGTGTCGGCGCGGCTACAACAACGCGCCGACACCGCTTTGTAGGGGTGGTACTGACTATTTTTATAAAAAACATTATTTTATATTAGGGGTGCTGCTAGCGGCGCGGTGTGTTTTTTTATAGGATACCGCTAGGGGCGCTGCTAGCGGTGCGTCCCTGTTTGCATTATGAATTTTAGTGTTTCGAAATTAACTTTATTTTATGTTCAAAAAAGGTAATCTCTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   1623 GenBank   WP_001064245
Name   traC_KZ488_RS23810_p31HGR-CBG insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99159.81 Da        Isoelectric Point: 5.8486

>WP_001064245.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNVADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

Family of unknown function (DUF5934) (DUF5934)

(289-446)

TraC protein (TraC_F_IV)

(38-276)

TraG P-loop domain (P-loop_TraG)

(467-771)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 99054..121748

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KZ488_RS23720 (KZ488_23720) 94983..96352 + 1370 WP_085947770 IS3-like element IS150 family transposase -
KZ488_RS24305 96394..96543 + 150 Protein_110 plasmid maintenance protein Mok -
KZ488_RS23725 (KZ488_23725) 96485..96610 + 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
KZ488_RS24310 96830..97060 + 231 WP_071586998 hypothetical protein -
KZ488_RS24315 97058..97230 - 173 Protein_113 hypothetical protein -
KZ488_RS24320 97300..97506 + 207 WP_000547968 hypothetical protein -
KZ488_RS23730 (KZ488_23730) 97531..97818 + 288 WP_000107535 hypothetical protein -
KZ488_RS23735 (KZ488_23735) 97936..98757 + 822 WP_001234426 DUF932 domain-containing protein -
KZ488_RS23740 (KZ488_23740) 99054..99656 - 603 WP_013362798 transglycosylase SLT domain-containing protein virB1
KZ488_RS23745 (KZ488_23745) 99977..100360 + 384 WP_001151524 conjugal transfer relaxosome DNA-binding protein TraM -
KZ488_RS23750 (KZ488_23750) 100547..101236 + 690 WP_000283385 conjugal transfer transcriptional regulator TraJ -
KZ488_RS23755 (KZ488_23755) 101329..101730 + 402 WP_001369361 conjugal transfer relaxosome DNA-bindin protein TraY -
KZ488_RS23760 (KZ488_23760) 101763..102128 + 366 WP_000994779 type IV conjugative transfer system pilin TraA -
KZ488_RS23765 (KZ488_23765) 102143..102454 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
KZ488_RS23770 (KZ488_23770) 102476..103042 + 567 WP_021514868 type IV conjugative transfer system protein TraE traE
KZ488_RS23775 (KZ488_23775) 103029..103757 + 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
KZ488_RS23780 (KZ488_23780) 103757..105184 + 1428 WP_000146685 F-type conjugal transfer pilus assembly protein TraB traB
KZ488_RS23785 (KZ488_23785) 105174..105764 + 591 WP_000002787 conjugal transfer pilus-stabilizing protein TraP -
KZ488_RS23790 (KZ488_23790) 105718..105948 + 231 WP_001352845 conjugal transfer protein TrbD -
KZ488_RS23795 (KZ488_23795) 105960..106211 + 252 WP_001038342 conjugal transfer protein TrbG -
KZ488_RS23800 (KZ488_23800) 106208..106723 + 516 WP_000809838 type IV conjugative transfer system lipoprotein TraV traV
KZ488_RS23805 (KZ488_23805) 106858..107079 + 222 WP_001278689 conjugal transfer protein TraR -
KZ488_RS23810 (KZ488_23810) 107239..109866 + 2628 WP_001064245 type IV secretion system protein TraC virb4
KZ488_RS23815 (KZ488_23815) 109863..110249 + 387 WP_000099686 type-F conjugative transfer system protein TrbI -
KZ488_RS23820 (KZ488_23820) 110246..110878 + 633 WP_001203720 type-F conjugative transfer system protein TraW traW
KZ488_RS23825 (KZ488_23825) 110875..111867 + 993 WP_000830180 conjugal transfer pilus assembly protein TraU traU
KZ488_RS23830 (KZ488_23830) 111876..112514 + 639 WP_021518374 type-F conjugative transfer system pilin assembly protein TrbC trbC
KZ488_RS23835 (KZ488_23835) 112511..114319 + 1809 WP_000821840 type-F conjugative transfer system mating-pair stabilization protein TraN traN
KZ488_RS23840 (KZ488_23840) 114346..114603 + 258 WP_000864312 conjugal transfer protein TrbE -
KZ488_RS23845 (KZ488_23845) 114596..115339 + 744 WP_001030378 type-F conjugative transfer system pilin assembly protein TraF traF
KZ488_RS23850 (KZ488_23850) 115353..115694 + 342 WP_000556794 conjugal transfer protein TrbA -
KZ488_RS23855 (KZ488_23855) 115675..116010 - 336 WP_000415571 hypothetical protein -
KZ488_RS23860 (KZ488_23860) 116091..116375 + 285 WP_000624105 type-F conjugative transfer system pilin chaperone TraQ -
KZ488_RS23865 (KZ488_23865) 116362..116916 + 555 WP_001553830 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
KZ488_RS23870 (KZ488_23870) 116846..117220 + 375 WP_071788165 P-type conjugative transfer protein TrbJ -
KZ488_RS23875 (KZ488_23875) 117174..117566 + 393 WP_000164675 F-type conjugal transfer protein TrbF -
KZ488_RS23880 (KZ488_23880) 117553..118926 + 1374 WP_021518370 conjugal transfer pilus assembly protein TraH traH
KZ488_RS23885 (KZ488_23885) 118923..121748 + 2826 WP_001553826 conjugal transfer mating-pair stabilization protein TraG traG
KZ488_RS23890 (KZ488_23890) 121745..122254 + 510 WP_000628100 conjugal transfer entry exclusion protein TraS -
KZ488_RS23895 (KZ488_23895) 122268..122999 + 732 WP_000850424 conjugal transfer complement resistance protein TraT -
KZ488_RS23900 (KZ488_23900) 123251..125170 + 1920 Protein_149 type IV conjugative transfer system coupling protein TraD -
KZ488_RS23905 (KZ488_23905) 125081..125281 - 201 Protein_150 hypothetical protein -
KZ488_RS23910 (KZ488_23910) 125384..125566 + 183 WP_000968309 hypothetical protein -
KZ488_RS23915 (KZ488_23915) 125810..125959 + 150 WP_001312851 Hok/Gef family protein -
KZ488_RS23920 (KZ488_23920) 126243..126500 + 258 WP_000083833 replication regulatory protein RepA -

Host bacterium

ID   3130 GenBank   NZ_CP080646
Plasmid name   p31HGR-CBG Incompatibility group   IncFIA
Plasmid size   145301 bp Coordinate of oriT [Strand]   99625..99976 [+]
Host baterium   Escherichia coli strain 31HGR-CBG

Cargo genes

Drug resistance gene   tet(B), blaCTX-M-15, aac(6')-Ib-cr, blaOXA-1, sitABCD, sul1, qacE, aadA5
Virulence gene   iucA, iucB, iucC, iutA
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -