Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   102679
Name   oriT_pSCU-204-1 in_silico
Organism   Escherichia coli strain SCU-204
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP053253 (157836..157924 [+], 89 nt)
oriT length   89 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 89 nt

>oriT_pSCU-204-1
GGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCATTTTTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1618 GenBank   WP_001289276
Name   t4cp2_HHJ42_RS25965_pSCU-204-1 insolico UniProt ID   _
Length   763 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 763 a.a.        Molecular weight: 86941.11 Da        Isoelectric Point: 6.7713

>WP_001289276.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MSEHRVNPELLHRTAWGNPVWNALQSLNIYGFCLVASLVASFIWPLALPACLLFTLITMLVFSLQRWRCP
LRMPMTLECADPSQDRMIKRSLFSFWPTLFQYEVILESPASGIFYVGYQRVRDIGRELWLSMDDLTRHIM
FFATTGGGKTETIFAWAINPLCWARGFTLVDGKAQNDTARTIWYLARRFGREDDVEVINFMNGGKSRSEI
ILSGEKTRPQSNTWNPFCYSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDLSLVRTPSAWTEEPRKQHAYLSGQFSE
TFSTFTEAFGDIFAEDSGDIDIRDSIHSDRILMVMIPALDTSAHTTSALGRMFITQKSMILARDLGYRLE
GTDSDALEVKKYKGRFPYLCFLDEVGAYYTDRIAVEATQVRSLDFALILMAQDQERIEGQTTATNTATLM
QNTGTKFAGRIVSEGSTARTLKSAAGEEARARMNNLQRQDGIFGESWIDSPQISILMESKINVQELIELH
PGEFFSIFRGETVPSASFFIPDDEKSCSSDPVVINRYISVDAPRLDRLRRLVPRTTQRRIPSPENVSAII
GVLTAKPSRKRRKIRTEPHTIVDTFQQRIAGRQAAMAMLEEYDTDINARESALWETAVNTLKTTTREERR
IRYITLNRPELPETKEENQISVRAERAGINLLTLPQDNNHPTGRPVNGFHHKKTNRPDWDGMY

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 114156..152459

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HHJ42_RS25745 (HHJ42_25750) 109218..110285 + 1068 WP_171274542 type IV pilus biogenesis lipoprotein PilL -
HHJ42_RS25750 (HHJ42_25755) 110285..110722 + 438 WP_000539807 type IV pilus biogenesis protein PilM -
HHJ42_RS25755 (HHJ42_25760) 110736..112418 + 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
HHJ42_RS25760 (HHJ42_25765) 112411..113706 + 1296 WP_021560540 type 4b pilus protein PilO2 -
HHJ42_RS25765 (HHJ42_25770) 113693..114145 + 453 WP_001247336 type IV pilus biogenesis protein PilP -
HHJ42_RS25770 (HHJ42_25775) 114156..115709 + 1554 WP_000362202 ATPase, T2SS/T4P/T4SS family virB11
HHJ42_RS25775 (HHJ42_25780) 115722..116819 + 1098 WP_171274543 type II secretion system F family protein -
HHJ42_RS25780 (HHJ42_25785) 116837..117451 + 615 WP_000959785 type 4 pilus major pilin -
HHJ42_RS25785 (HHJ42_25790) 117461..118021 + 561 WP_000014116 lytic transglycosylase domain-containing protein virB1
HHJ42_RS25790 (HHJ42_25795) 118006..118662 + 657 WP_001193553 prepilin peptidase -
HHJ42_RS25795 (HHJ42_25800) 118662..120092 + 1431 Protein_138 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HHJ42_RS25800 (HHJ42_25805) 121374..121592 - 219 WP_071527775 shufflon protein D' -
HHJ42_RS25805 (HHJ42_25810) 121641..121727 - 87 Protein_140 shufflon protein D' -
HHJ42_RS25810 (HHJ42_25815) 121726..122880 + 1155 WP_001139957 site-specific integrase -
HHJ42_RS25815 (HHJ42_25820) 123031..123855 + 825 WP_001238939 conjugal transfer protein TraE traE
HHJ42_RS25820 (HHJ42_25825) 123940..125142 + 1203 WP_000976351 conjugal transfer protein TraF -
HHJ42_RS25825 (HHJ42_25830) 125202..125786 + 585 WP_000977522 histidine phosphatase family protein -
HHJ42_RS25830 (HHJ42_25835) 126181..126633 + 453 Protein_145 IncI1-type conjugal transfer lipoprotein TraH -
HHJ42_RS25835 (HHJ42_25840) 126634..127453 + 820 Protein_146 IncI1-type conjugal transfer lipoprotein TraI -
HHJ42_RS25840 (HHJ42_25845) 127450..128598 + 1149 WP_080242523 plasmid transfer ATPase TraJ virB11
HHJ42_RS25845 (HHJ42_25850) 128595..128885 + 291 WP_001299214 hypothetical protein traK
HHJ42_RS25850 (HHJ42_25855) 128900..129451 + 552 WP_000014583 phospholipase D family protein -
HHJ42_RS25855 (HHJ42_25860) 129541..133306 + 3766 Protein_150 DNA primase -
HHJ42_RS25860 (HHJ42_25865) 133324..133671 + 348 WP_001055900 conjugal transfer protein traL
HHJ42_RS25865 (HHJ42_25870) 133668..134360 + 693 WP_000138550 DotI/IcmL family type IV secretion protein traM
HHJ42_RS25870 (HHJ42_25875) 134371..135354 + 984 WP_001191877 IncI1-type conjugal transfer protein TraN traN
HHJ42_RS25875 (HHJ42_25880) 135357..136646 + 1290 WP_001272003 conjugal transfer protein TraO traO
HHJ42_RS25880 (HHJ42_25885) 136646..137350 + 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
HHJ42_RS25885 (HHJ42_25890) 137350..137877 + 528 WP_001055569 conjugal transfer protein TraQ traQ
HHJ42_RS25890 (HHJ42_25895) 137928..138332 + 405 WP_000086958 IncI1-type conjugal transfer protein TraR traR
HHJ42_RS25895 (HHJ42_25900) 138396..138584 + 189 WP_001277255 putative conjugal transfer protein TraS -
HHJ42_RS25900 (HHJ42_25905) 138568..139368 + 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
HHJ42_RS25905 (HHJ42_25910) 139458..142502 + 3045 WP_001024782 IncI1-type conjugal transfer protein TraU traU
HHJ42_RS25910 (HHJ42_25915) 142502..143116 + 615 WP_000337399 IncI1-type conjugal transfer protein TraV traV
HHJ42_RS25915 (HHJ42_25920) 143083..144285 + 1203 WP_001385654 IncI1-type conjugal transfer protein TraW traW
HHJ42_RS25920 (HHJ42_25925) 144314..144898 + 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
HHJ42_RS25925 (HHJ42_25930) 144995..147163 + 2169 WP_171274544 DotA/TraY family protein traY
HHJ42_RS25930 (HHJ42_25935) 147237..147887 + 651 WP_032179289 plasmid IncI1-type surface exclusion protein ExcA -
HHJ42_RS25935 (HHJ42_25940) 147959..148168 - 210 WP_000062603 HEAT repeat domain-containing protein -
HHJ42_RS25940 (HHJ42_25945) 148560..148736 + 177 WP_001054897 hypothetical protein -
HHJ42_RS25945 (HHJ42_25950) 149395..149646 + 252 WP_001291964 hypothetical protein -
HHJ42_RS25950 (HHJ42_25955) 149718..149870 - 153 WP_001331364 Hok/Gef family protein -
HHJ42_RS25955 (HHJ42_25960) 150162..151370 + 1209 WP_000121273 IncI1-type conjugal transfer protein TrbA trbA
HHJ42_RS25960 (HHJ42_25965) 151389..152459 + 1071 WP_000151583 IncI1-type conjugal transfer protein TrbB trbB
HHJ42_RS25965 (HHJ42_25970) 152452..154743 + 2292 WP_001289276 F-type conjugative transfer protein TrbC -


Host bacterium


ID   3123 GenBank   NZ_CP053253
Plasmid name   pSCU-204-1 Incompatibility group   IncFIA
Plasmid size   174260 bp Coordinate of oriT [Strand]   157836..157924 [+]
Host baterium   Escherichia coli strain SCU-204

Cargo genes


Drug resistance gene   sul2, aph(3'')-Ib, aph(6)-Id
Virulence gene   senB
Metal resistance gene   merE, merD, merA, merP, merT, merR
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -