Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102664
Name   oriT_p46-2 in_silico
Organism   Escherichia coli strain UPEC-46
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAHBCK010000004 (32940..33012 [-], 73 nt)
oriT length   73 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 73 nt

>oriT_p46-2
GTCGGGGCAAAGCCCTGACCAGGTGGGGAATGTCTGAGTGCGCGTGCGCGGTCCGACATTCCCACATCCTGTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   1972 GenBank   WP_042960744
Name   Relaxase_KHO38_RS24100_p46-2 insolico UniProt ID   _
Length   903 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 903 a.a.        Molecular weight: 104496.86 Da        Isoelectric Point: 7.5347

>WP_042960744.1 relaxase/mobilization nuclease domain-containing protein [Escherichia coli]
MNAIIPHKRRDGRSSFEDLIAYTSVRDDVQENELTEDSEIKSDVPHRNRFRRLVDYATRLRNEKFVSLID
VMKDGSQWVNFYGVTCFHNCNSLETAAEEMQYKADKAVFSRNDTDPVFHYILSWPAHESPRPEQLFDCVR
HTLKSLELSKHQYVAAVHTDTDNLHVHVAVNRVHPETGYINWLSWSQEKLSRACRELELKHGFAPDNGCF
VHAPGNRIVRKTALVRERRNAWRRGKKQTFREYIAQMSIAGLREEPAQDWLSLHKRLASDGLYITMQEGE
LVVKDGWDRAREGVALSSFGPSWTAEKLGRKLGEYQPVPTDIFSQVGTPGRYDPEAINVDIRPEKVAETE
SLKQYACRHFAERLPEMARNGELESCLDVHRTLAKAGLWMGIQHGHLVLHDGFDKQQTPVRADSVWPLMT
LDYMQDLDGGWQPVPKDIFTQVIPGERFRGRNLGTQAVSDYEWYRIRMGTGPQGAIKRELFSDKESLWGY
TTVQCESLIEDMIAGGNFSWQACHEMFARKGLMLQKQHHGLVIVDAFNHELTPVKASSIHPDLTLSRAEP
QAGPFEIAGADIFERVKPECRYNPELAASDEVELGFRRDPVLRRERREARAAAREDLRARYLAWKEHWRK
PDLRYGERLREIHAACRRRKAYIRVQFRDPQLRKLHYHIAEVQRMQALIRLKESVKEERLSLIAEGKWYP
LSYRQWVEQQAVQGDRAALSQLRGWDYRDRRKDKRRTTNADRCVILCEPGGTPLYEDTGVLEARLQKDGS
VRFRDRRNGELVCVDYGDRVVFYHHQDRNELVDKLNLIAPVLFDREPGMGFEPEGSYQQFNDVFAEMVAW
HNAAGITGSGHFVISRPDVDLHRQRSEQYYHEYIRQQKSISGGHGASYAPVQDNEWTPPSPGM

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(62-315)


  Protein structure



No available structure.




Auxiliary protein

ID   796 GenBank   WP_001291058
Name   WP_001291058_p46-2 insolico UniProt ID   A0A7I0L241
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12730.52 Da        Isoelectric Point: 9.9656

>WP_001291058.1 MULTISPECIES: plasmid mobilization protein MobA [Enterobacteriaceae]
MSEKKTRTGSENRKRIVKFTARFTEDEAEIVREKAESSGQTVSTFIRSSSLDKVVNCRTDDRMIDEIMRL
GRLQKHLFVEGKRTGDKEYAEVLVAITEYVNALRRDLMGR

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB A0A7I0L241


T4CP

ID   1608 GenBank   WP_000077663
Name   trbC_KHO38_RS24210_p46-2 insolico UniProt ID   _
Length   767 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 767 a.a.        Molecular weight: 87012.13 Da        Isoelectric Point: 7.3008

>WP_000077663.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MSQHHVNPDLIHRTAWGNPLWNALHNLNITGLCLAGSIITALIWPLALPVCLLFTLVTSVIFMLQRWRCP
LRMPMTLSLDDPSQDRKVRRSLFSFWPTLFQYEADETFPARGIFYVGYRRINDIGRELWLSMDDLTRHVM
FFATTGGGKTETTFAWLLNPLCWGRGFTFVDGKAQNDTTRTIWYLSRRFGREDDIEVINFMNGGKSRSEI
IQSGEKSRPQSNTWNPFAFSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDMSLVRTPSAWTEEPRKQHAYLSGQFSE
TFTTFAETFGDVFAADAGDIDIRDSIHSDRILIVMIPALDTSAHTTSALGRMFVTQQSMLLARDLGYRLE
GTDAQTLEVKKYKGSFPYICILDEVGAYYTDRIAVEATQVRSLEFSLIMTAQDQERIEGQTSATNTATLM
QNAGTKFAGRIVSDDKTARTVKNAAGEEARARMGSLQRHDGVMGESWVDGNQITIQMESKIDVQDLIRLN
AGEFFTVFQGDVVPSASVYIPDSEKSCDSDPVVINRYISVEAPRLERLRRLVPRTVQRRLPTPEHVSSII
GVLTAKPSRKRRKNRTEPYRIIDTFQRQLATAQTSLDLLPQYDTDIESRANELWKKAVHTINNTTREERR
VCYITLNRPEEEHSGPEDIPSVKAILNTLLPLEMLLPVPDLTASPPHKKNVAQTPSGGKQESRKKRF

  Protein domains


Predicted by InterproScan.

TraM recognition site of TraD and TraG (TraG-D_C)

(439-528)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 58866..98128

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KHO38_RS24200 (KHO38_24200) 54574..54816 - 243 Protein_67 phosphoglucosamine mutase -
KHO38_RS24205 (KHO38_24205) 54903..55718 - 816 WP_001043260 sulfonamide-resistant dihydropteroate synthase Sul2 -
KHO38_RS24210 (KHO38_24210) 56582..58885 - 2304 WP_000077663 F-type conjugative transfer protein TrbC -
KHO38_RS24215 (KHO38_24215) 58866..59990 - 1125 WP_000152378 DsbC family protein trbB
KHO38_RS24220 (KHO38_24220) 59987..61294 - 1308 WP_000121918 IncI1-type conjugal transfer protein TrbA trbA
KHO38_RS24225 (KHO38_24225) 61632..61778 + 147 WP_001346191 hypothetical protein -
KHO38_RS25485 61831..61926 + 96 WP_001388983 DinQ-like type I toxin DqlB -
KHO38_RS25490 62515..62610 + 96 WP_001363141 DinQ-like type I toxin DqlB -
KHO38_RS24235 (KHO38_24235) 62673..62849 - 177 WP_001054907 hypothetical protein -
KHO38_RS24240 (KHO38_24240) 62999..63466 - 468 WP_000598962 thermonuclease family protein -
KHO38_RS24245 (KHO38_24245) 63625..64248 + 624 WP_001155252 helix-turn-helix domain-containing protein -
KHO38_RS24250 (KHO38_24250) 64446..64661 - 216 WP_000266543 hypothetical protein -
KHO38_RS24255 (KHO38_24255) 64665..65033 - 369 WP_001345852 hypothetical protein -
KHO38_RS24260 (KHO38_24260) 65045..65236 - 192 WP_000751583 hypothetical protein -
KHO38_RS24265 (KHO38_24265) 65324..65566 - 243 WP_000650923 hypothetical protein -
KHO38_RS24270 (KHO38_24270) 65896..66048 + 153 WP_001335079 Hok/Gef family protein -
KHO38_RS24275 (KHO38_24275) 66186..67772 - 1587 WP_000004563 TnsA endonuclease N-terminal domain-containing protein -
KHO38_RS24280 (KHO38_24280) 68046..68699 - 654 WP_001401768 plasmid IncI1-type surface exclusion protein ExcA -
KHO38_RS24285 (KHO38_24285) 68787..70952 - 2166 WP_000691808 DotA/TraY family protein traY
KHO38_RS24290 (KHO38_24290) 71027..71596 - 570 WP_000650752 conjugal transfer protein TraX -
KHO38_RS24295 (KHO38_24295) 71593..72798 - 1206 WP_001189548 conjugal transfer protein TraW traW
KHO38_RS24300 (KHO38_24300) 72756..73376 - 621 WP_000286854 hypothetical protein traV
KHO38_RS24305 (KHO38_24305) 73376..76420 - 3045 WP_001024766 conjugal transfer protein traU
KHO38_RS24310 (KHO38_24310) 76715..77533 - 819 WP_072105968 conjugal transfer protein TraT traT
KHO38_RS25495 (KHO38_24315) 77448..77699 - 252 WP_001277573 hypothetical protein -
KHO38_RS24320 (KHO38_24320) 77756..78154 - 399 WP_000088813 DUF6750 family protein traR
KHO38_RS24325 (KHO38_24325) 78201..78731 - 531 WP_000987021 conjugal transfer protein TraQ traQ
KHO38_RS24330 (KHO38_24330) 78728..79441 - 714 WP_000787003 conjugal transfer protein TraP traP
KHO38_RS24335 (KHO38_24335) 79438..80775 - 1338 WP_001272018 conjugal transfer protein TraO traO
KHO38_RS24340 (KHO38_24340) 80779..81753 - 975 WP_000547385 DotH/IcmK family type IV secretion protein traN
KHO38_RS24345 (KHO38_24345) 81764..82459 - 696 WP_001287545 DotI/IcmL family type IV secretion protein traM
KHO38_RS24350 (KHO38_24350) 82471..82821 - 351 WP_001056367 hypothetical protein traL
KHO38_RS24355 (KHO38_24355) 82838..86899 - 4062 WP_000842453 LPD7 domain-containing protein -
KHO38_RS24360 (KHO38_24360) 86963..87253 - 291 WP_000817801 IcmT/TraK family protein traK
KHO38_RS24365 (KHO38_24365) 87250..88398 - 1149 WP_000775210 plasmid transfer ATPase TraJ virB11
KHO38_RS24370 (KHO38_24370) 88382..89218 - 837 WP_000745049 type IV secretory system conjugative DNA transfer family protein traI
KHO38_RS24375 (KHO38_24375) 89215..89673 - 459 WP_001170111 DotD/TraH family lipoprotein -
KHO38_RS24380 (KHO38_24380) 89777..90979 - 1203 WP_000979994 conjugal transfer protein TraF -
KHO38_RS24385 (KHO38_24385) 91081..91902 - 822 WP_000845373 hypothetical protein traE
KHO38_RS25330 92067..92261 - 195 Protein_106 integrase -
KHO38_RS24390 (KHO38_24390) 92375..93736 - 1362 WP_001168171 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
KHO38_RS24395 (KHO38_24395) 93754..94380 - 627 WP_000939245 prepilin peptidase -
KHO38_RS24400 (KHO38_24400) 94396..94881 - 486 WP_001080767 lytic transglycosylase domain-containing protein virB1
KHO38_RS24405 (KHO38_24405) 94926..95462 - 537 WP_000111534 type 4 pilus major pilin -
KHO38_RS24410 (KHO38_24410) 95524..96618 - 1095 WP_000697158 type II secretion system F family protein -
KHO38_RS24415 (KHO38_24415) 96620..98128 - 1509 WP_000880807 ATPase, T2SS/T4P/T4SS family virB11
KHO38_RS24420 (KHO38_24420) 98231..98689 - 459 WP_000095885 type IV pilus biogenesis protein PilP -
KHO38_RS24425 (KHO38_24425) 98679..99974 - 1296 WP_000129883 type 4b pilus protein PilO2 -
KHO38_RS24430 (KHO38_24430) 99995..101614 - 1620 WP_001035558 PilN family type IVB pilus formation outer membrane protein -
KHO38_RS24435 (KHO38_24435) 101646..102083 - 438 WP_000539950 type IV pilus biogenesis protein PilM -

Host bacterium

ID   3108 GenBank   NZ_JAHBCK010000004
Plasmid name   p46-2 Incompatibility group   IncB/O/K/Z
Plasmid size   108910 bp Coordinate of oriT [Strand]   32940..33012 [-]
Host baterium   Escherichia coli strain UPEC-46

Cargo genes

Drug resistance gene   dfrA1, ant(3'')-Ia, tet(B), sul2
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -