Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102653
Name   oriT_Ec47VL|unnamed3 in_silico
Organism   Escherichia coli strain Ec47VL
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_LYPE01000036 (19551..19674 [-], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      92..99, 113..120  (ATAATGTA..TACATTAT)
 90..95, 107..112  (AAATAA..TTATTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_Ec47VL|unnamed3
GGTTGGTGGTTCTCACCACCAAAAGCACCACACACTACGCAAAAACAAGTTTTTGCTGATTTGCTACTTGAATCATTAACTTATGTTTTAAATAATGTATTTTAATTTATTTTACATTATAAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   1602 GenBank   WP_069354187
Name   traC_A9D65_RS17305_Ec47VL|unnamed3 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99194.77 Da        Isoelectric Point: 6.1126

>WP_069354187.1 type IV secretion system protein TraC [Escherichia coli]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGVPFCIHLKSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMNAAA
TQFPLPEGMNLPLTLRHYRVFFSYCSPSKKKSRADILEMENLVKIIRASLQGASIATQTVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVKQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAGSPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNYKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFQPLQRDMIGKFGAARDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

TraC protein (TraC_F_IV)

(38-276)

TraG P-loop domain (P-loop_TraG)

(467-763)

Family of unknown function (DUF5934) (DUF5934)

(289-446)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 3976..20246

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A9D65_RS28360 (A9D65_24180) 1..248 - 248 WP_069354188 IS1-like element transposase -
A9D65_RS17245 (A9D65_24185) 403..1176 - 774 Protein_1 IS5-like element ISKpn26 family transposase -
A9D65_RS17250 (A9D65_24190) 1259..1663 + 405 WP_000839179 transposase -
A9D65_RS17255 (A9D65_24195) 1660..2007 + 348 WP_000612626 IS66 family insertion sequence element accessory protein TnpB -
A9D65_RS17260 (A9D65_24200) 2056..3595 + 1540 Protein_4 IS66-like element ISEc22 family transposase -
A9D65_RS28970 3634..3846 - 213 Protein_5 IS5/IS1182 family transposase -
A9D65_RS17265 (A9D65_24205) 3976..4719 - 744 WP_001030401 type-F conjugative transfer system pilin assembly protein TraF traF
A9D65_RS17270 (A9D65_24210) 4712..4969 - 258 WP_000864347 conjugal transfer protein TrbE -
A9D65_RS17275 (A9D65_24215) 4996..6846 - 1851 WP_000821866 type-F conjugative transfer system mating-pair stabilization protein TraN traN
A9D65_RS17280 (A9D65_24220) 6843..7481 - 639 WP_001080259 type-F conjugative transfer system pilin assembly protein TrbC trbC
A9D65_RS17285 (A9D65_24225) 7490..7795 - 306 WP_000224413 hypothetical protein -
A9D65_RS17290 (A9D65_24230) 7825..8817 - 993 WP_000830190 conjugal transfer pilus assembly protein TraU traU
A9D65_RS17295 (A9D65_24235) 8814..9446 - 633 WP_001203727 type-F conjugative transfer system protein TraW traW
A9D65_RS17300 (A9D65_24240) 9443..9829 - 387 WP_000214084 type-F conjugative transfer system protein TrbI -
A9D65_RS17305 (A9D65_24245) 9826..12453 - 2628 WP_069354187 type IV secretion system protein TraC virb4
A9D65_RS27215 12613..12834 - 222 WP_001278694 conjugal transfer protein TraR -
A9D65_RS17310 (A9D65_24250) 12969..13484 - 516 WP_000809886 type IV conjugative transfer system lipoprotein TraV traV
A9D65_RS17315 (A9D65_24255) 13484..13795 - 312 WP_001057272 conjugal transfer protein TrbD -
A9D65_RS17320 (A9D65_24260) 13782..14348 - 567 WP_000896601 conjugal transfer pilus-stabilizing protein TraP -
A9D65_RS17325 (A9D65_24265) 14338..15789 - 1452 WP_000146687 F-type conjugal transfer pilus assembly protein TraB traB
A9D65_RS17330 (A9D65_24270) 15789..16517 - 729 WP_001230808 type-F conjugative transfer system secretin TraK traK
A9D65_RS17335 (A9D65_24275) 16504..17070 - 567 WP_000399791 type IV conjugative transfer system protein TraE traE
A9D65_RS17340 (A9D65_24280) 17092..17403 - 312 WP_000012107 type IV conjugative transfer system protein TraL traL
A9D65_RS17345 (A9D65_24285) 17408..17770 - 363 WP_000338606 type IV conjugative transfer system pilin TraA -
A9D65_RS17350 (A9D65_24290) 17804..18031 - 228 WP_001254388 conjugal transfer relaxosome protein TraY -
A9D65_RS17355 (A9D65_24295) 18119..18796 - 678 WP_001348626 PAS domain-containing protein -
A9D65_RS17360 (A9D65_24300) 18930..19313 - 384 WP_001151566 conjugal transfer relaxosome DNA-binding protein TraM -
A9D65_RS17365 (A9D65_24305) 19656..20246 + 591 WP_001376243 transglycosylase SLT domain-containing protein virB1
A9D65_RS17370 (A9D65_24310) 20543..21364 - 822 WP_001234469 DUF932 domain-containing protein -
A9D65_RS17375 (A9D65_24315) 21483..21770 - 288 WP_000107535 hypothetical protein -
A9D65_RS17380 (A9D65_24320) 21795..22001 - 207 WP_000275859 hypothetical protein -
A9D65_RS30110 22071..22219 + 149 Protein_31 hypothetical protein -

Host bacterium

ID   3097 GenBank   NZ_LYPE01000036
Plasmid name   Ec47VL|unnamed3 Incompatibility group   -
Plasmid size   22219 bp Coordinate of oriT [Strand]   19551..19674 [-]
Host baterium   Escherichia coli strain Ec47VL

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -