Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102646
Name   oriT_pECSJ33 in_silico
Organism   Escherichia coli strain SJ33
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JASIRV010000085 (15556..15608 [+], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pECSJ33
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   1594 GenBank   WP_015059539
Name   t4cp2_QLH35_RS23805_pECSJ33 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73404.02 Da        Isoelectric Point: 9.4339

>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

Type IV secretory system Conjugative DNA transfer (T4SS-DNA_transf)

(127-591)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 34557..57387

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLH35_RS23670 (QLH35_23650) 30469..30921 + 453 WP_000101552 CaiF/GrlA family transcriptional regulator -
QLH35_RS23675 (QLH35_23655) 30914..31129 + 216 WP_001127357 DUF1187 family protein -
QLH35_RS23680 (QLH35_23660) 31122..31298 + 177 WP_000753050 hypothetical protein -
QLH35_RS23685 (QLH35_23665) 31325..32278 + 954 WP_072089442 SPFH domain-containing protein -
QLH35_RS23690 (QLH35_23670) 32652..33095 + 444 WP_000964330 NfeD family protein -
QLH35_RS23695 (QLH35_23675) 33099..33269 + 171 WP_000550720 hypothetical protein -
QLH35_RS23700 (QLH35_23680) 33280..33726 + 447 WP_001243165 hypothetical protein -
QLH35_RS23705 (QLH35_23685) 33759..34016 + 258 WP_001542015 hypothetical protein -
QLH35_RS23710 (QLH35_23690) 33997..34299 + 303 WP_001360345 hypothetical protein -
QLH35_RS23715 (QLH35_23695) 34296..34553 + 258 WP_000739144 hypothetical protein -
QLH35_RS23720 (QLH35_23700) 34557..35552 + 996 WP_001028540 type IV secretion system protein virB6
QLH35_RS23725 (QLH35_23705) 35558..36202 + 645 WP_001310442 type IV secretion system protein -
QLH35_RS23730 (QLH35_23710) 36211..36435 + 225 WP_000713562 EexN family lipoprotein -
QLH35_RS23905 36658..37467 - 810 Protein_48 DUF5710 domain-containing protein -
QLH35_RS23745 (QLH35_23725) 37515..37814 + 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
QLH35_RS23750 (QLH35_23730) 37817..39052 + 1236 WP_034169417 toxin co-regulated pilus biosynthesis Q family protein -
QLH35_RS23755 (QLH35_23735) 39058..39495 + 438 WP_034169416 type IV pilus biogenesis protein PilM -
QLH35_RS23760 (QLH35_23740) 39614..40012 + 399 WP_001153669 hypothetical protein -
QLH35_RS23765 (QLH35_23745) 40033..40617 + 585 WP_001177117 lytic transglycosylase domain-containing protein virB1
QLH35_RS23770 (QLH35_23750) 40617..40907 + 291 WP_000865479 conjugal transfer protein -
QLH35_RS23775 (QLH35_23755) 40978..41298 + 321 WP_000362080 VirB3 family type IV secretion system protein virB3
QLH35_RS23780 (QLH35_23760) 41304..43661 + 2358 WP_000548950 VirB4 family type IV secretion system protein virb4
QLH35_RS23785 (QLH35_23765) 43827..44561 + 735 WP_000432282 type IV secretion system protein virB8
QLH35_RS23790 (QLH35_23770) 44627..45328 + 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
QLH35_RS23795 (QLH35_23775) 45318..46457 + 1140 WP_034169415 TrbI/VirB10 family protein virB10
QLH35_RS23800 (QLH35_23780) 46476..47531 + 1056 WP_001542006 P-type DNA transfer ATPase VirB11 virB11
QLH35_RS23805 (QLH35_23785) 47547..49505 + 1959 WP_015059539 type IV secretory system conjugative DNA transfer family protein -
QLH35_RS23810 (QLH35_23790) 49552..50088 + 537 WP_001220543 sigma 54-interacting transcriptional regulator virb4
QLH35_RS23815 (QLH35_23795) 50081..51724 + 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
QLH35_RS23820 (QLH35_23800) 51775..53085 + 1311 WP_001454111 type 4b pilus protein PilO2 -
QLH35_RS23825 (QLH35_23805) 53069..53563 + 495 WP_000912553 type IV pilus biogenesis protein PilP -
QLH35_RS23830 (QLH35_23810) 53588..55126 + 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
QLH35_RS23835 (QLH35_23815) 55117..56226 + 1110 WP_000974903 type II secretion system F family protein -
QLH35_RS23840 (QLH35_23820) 56276..56839 + 564 WP_034169414 type 4 pilus major pilin -
QLH35_RS23845 (QLH35_23825) 56905..57387 + 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
QLH35_RS23850 (QLH35_23830) 57391..58026 + 636 WP_000934977 A24 family peptidase -
QLH35_RS23855 (QLH35_23835) 58039..59080 + 1042 WP_000750515 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -

Host bacterium

ID   3090 GenBank   NZ_JASIRV010000085
Plasmid name   pECSJ33 Incompatibility group   IncI2
Plasmid size   59080 bp Coordinate of oriT [Strand]   15556..15608 [+]
Host baterium   Escherichia coli strain SJ33

Cargo genes

Drug resistance gene   mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -