Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   102643
Name   oriT_SYAU2|unnamed1 in_silico
Organism   Escherichia coli strain SYAU2
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_LNUH01000042 (2428..2551 [+], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      101..106, 119..124  (TTTAAT..ATTAAA)
 91..99, 113..121  (AATAATGTA..TACATTATT)
 90..95, 107..112  (AAATAA..TTATTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_SYAU2|unnamed1
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGCTTTTTGAATCATTAGCTTATGTTTTAAATAATGTATTTTAATTTATTTTACATTATTAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   1593 GenBank   WP_001064268
Name   traC_AYM07_RS24775_SYAU2|unnamed1 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99248.97 Da        Isoelectric Point: 6.0801

>WP_001064268.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGVPFCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMNAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQAVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKKNKARIDDVVDFLKNARDNDQYVESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

TraG P-loop domain (P-loop_TraG)

(467-771)

TraC protein (TraC_F_IV)

(38-276)

Family of unknown function (DUF5934) (DUF5934)

(289-446)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 1856..16225

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AYM07_RS24695 98..304 + 207 WP_000547939 hypothetical protein -
AYM07_RS24700 329..616 + 288 WP_000107535 hypothetical protein -
AYM07_RS24705 738..1559 + 822 WP_001234469 DUF932 domain-containing protein -
AYM07_RS24710 1856..2503 - 648 WP_000614936 transglycosylase SLT domain-containing protein virB1
AYM07_RS24715 2780..3163 + 384 WP_000124981 conjugal transfer relaxosome DNA-binding protein TraM -
AYM07_RS24720 3354..4040 + 687 WP_000332484 PAS domain-containing protein -
AYM07_RS24725 4134..4361 + 228 WP_001254386 conjugal transfer relaxosome protein TraY -
AYM07_RS24730 4395..4754 + 360 WP_000340272 type IV conjugative transfer system pilin TraA -
AYM07_RS24735 4769..5080 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
AYM07_RS24740 5102..5668 + 567 WP_000399792 type IV conjugative transfer system protein TraE traE
AYM07_RS24745 5655..6383 + 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
AYM07_RS24750 6383..7810 + 1428 WP_000146685 F-type conjugal transfer pilus assembly protein TraB traB
AYM07_RS24755 7800..8372 + 573 WP_000002780 conjugal transfer pilus-stabilizing protein TraP -
AYM07_RS24760 8369..8686 + 318 WP_001057292 conjugal transfer protein TrbD virb4
AYM07_RS24765 8683..8934 + 252 WP_001038341 conjugal transfer protein TrbG -
AYM07_RS24770 8931..9446 + 516 WP_000809906 type IV conjugative transfer system lipoprotein TraV traV
AYM07_RS27585 9581..9802 + 222 WP_001278689 conjugal transfer protein TraR -
AYM07_RS24775 9962..12589 + 2628 WP_001064268 type IV secretion system protein TraC virb4
AYM07_RS24780 12586..12972 + 387 WP_000214084 type-F conjugative transfer system protein TrbI -
AYM07_RS24785 12969..13601 + 633 WP_001203745 type-F conjugative transfer system protein TraW traW
AYM07_RS24790 13598..14590 + 993 WP_000830839 conjugal transfer pilus assembly protein TraU traU
AYM07_RS24795 14616..15077 + 462 WP_000277845 hypothetical protein -
AYM07_RS24800 15107..15559 + 453 WP_000069427 hypothetical protein -
AYM07_RS24805 15587..16225 + 639 WP_001104248 type-F conjugative transfer system pilin assembly protein TrbC trbC
AYM07_RS24810 16222..17082 + 861 Protein_24 conjugal transfer protein TraN -

Host bacterium

ID   3087 GenBank   NZ_LNUH01000042
Plasmid name   SYAU2|unnamed1 Incompatibility group   -
Plasmid size   17148 bp Coordinate of oriT [Strand]   2428..2551 [+]
Host baterium   Escherichia coli strain SYAU2

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -