Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   102640
Name   oriT_SYAU1|unnamed1 in_silico
Organism   Escherichia coli strain SYAU1
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_LNUG01000038 (14598..14721 [-], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      101..106, 119..124  (TTTAAT..ATTAAA)
 91..99, 113..121  (AATAATGTA..TACATTATT)
 90..95, 107..112  (AAATAA..TTATTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_SYAU1|unnamed1
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGCTTTTTGAATCATTAGCTTATGTTTTAAATAATGTATTTTAATTTATTTTACATTATTAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1590 GenBank   WP_001064268
Name   traC_AYM06_RS24595_SYAU1|unnamed1 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99248.97 Da        Isoelectric Point: 6.0801

>WP_001064268.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGVPFCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMNAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQAVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKKNKARIDDVVDFLKNARDNDQYVESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

(467-771)

(38-276)

(289-446)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 924..15293

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AYM06_RS24560 67..927 - 861 Protein_0 conjugal transfer protein TraN -
AYM06_RS24565 924..1562 - 639 WP_001104248 type-F conjugative transfer system pilin assembly protein TrbC trbC
AYM06_RS24570 1590..2042 - 453 WP_000069427 hypothetical protein -
AYM06_RS24575 2072..2533 - 462 WP_000277845 hypothetical protein -
AYM06_RS24580 2559..3551 - 993 WP_000830839 conjugal transfer pilus assembly protein TraU traU
AYM06_RS24585 3548..4180 - 633 WP_001203745 type-F conjugative transfer system protein TraW traW
AYM06_RS24590 4177..4563 - 387 WP_000214084 type-F conjugative transfer system protein TrbI -
AYM06_RS24595 4560..7187 - 2628 WP_001064268 type IV secretion system protein TraC virb4
AYM06_RS27425 7347..7568 - 222 WP_001278689 conjugal transfer protein TraR -
AYM06_RS24600 7703..8218 - 516 WP_000809906 type IV conjugative transfer system lipoprotein TraV traV
AYM06_RS24605 8215..8466 - 252 WP_001038341 conjugal transfer protein TrbG -
AYM06_RS24610 8463..8780 - 318 WP_001057292 conjugal transfer protein TrbD virb4
AYM06_RS24615 8777..9349 - 573 WP_000002780 conjugal transfer pilus-stabilizing protein TraP -
AYM06_RS24620 9339..10766 - 1428 WP_000146685 F-type conjugal transfer pilus assembly protein TraB traB
AYM06_RS24625 10766..11494 - 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
AYM06_RS24630 11481..12047 - 567 WP_000399792 type IV conjugative transfer system protein TraE traE
AYM06_RS24635 12069..12380 - 312 WP_000012106 type IV conjugative transfer system protein TraL traL
AYM06_RS24640 12395..12754 - 360 WP_000340272 type IV conjugative transfer system pilin TraA -
AYM06_RS24645 12788..13015 - 228 WP_001254386 conjugal transfer relaxosome protein TraY -
AYM06_RS24650 13109..13795 - 687 WP_000332484 PAS domain-containing protein -
AYM06_RS24655 13986..14369 - 384 WP_000124981 conjugal transfer relaxosome DNA-binding protein TraM -
AYM06_RS24660 14646..15293 + 648 WP_000614936 transglycosylase SLT domain-containing protein virB1
AYM06_RS24665 15590..16411 - 822 WP_001234469 DUF932 domain-containing protein -
AYM06_RS24670 16533..16820 - 288 WP_000107535 hypothetical protein -
AYM06_RS24675 16845..17051 - 207 WP_000547939 hypothetical protein -


Host bacterium


ID   3084 GenBank   NZ_LNUG01000038
Plasmid name   SYAU1|unnamed1 Incompatibility group   -
Plasmid size   17153 bp Coordinate of oriT [Strand]   14598..14721 [-]
Host baterium   Escherichia coli strain SYAU1

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -