Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   102639
Name   oriT_SYAU4|unnamed1 in_silico
Organism   Escherichia coli strain SYAU4
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_LNUJ01000036 (2432..2555 [+], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      101..106, 119..124  (TTTAAT..ATTAAA)
 91..99, 113..121  (AATAATGTA..TACATTATT)
 90..95, 107..112  (AAATAA..TTATTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_SYAU4|unnamed1
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGCTTTTTGAATCATTAGCTTATGTTTTAAATAATGTATTTTAATTTATTTTACATTATTAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   1589 GenBank   WP_001064268
Name   traC_AYM09_RS24630_SYAU4|unnamed1 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99248.97 Da        Isoelectric Point: 6.0801

>WP_001064268.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGVPFCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMNAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQAVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKKNKARIDDVVDFLKNARDNDQYVESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

(467-771)

(38-276)

(289-446)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1860..16229

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AYM09_RS24550 102..308 + 207 WP_000547939 hypothetical protein -
AYM09_RS24555 333..620 + 288 WP_000107535 hypothetical protein -
AYM09_RS24560 742..1563 + 822 WP_001234469 DUF932 domain-containing protein -
AYM09_RS24565 1860..2507 - 648 WP_000614936 transglycosylase SLT domain-containing protein virB1
AYM09_RS24570 2784..3167 + 384 WP_000124981 conjugal transfer relaxosome DNA-binding protein TraM -
AYM09_RS24575 3358..4044 + 687 WP_000332484 PAS domain-containing protein -
AYM09_RS24580 4138..4365 + 228 WP_001254386 conjugal transfer relaxosome protein TraY -
AYM09_RS24585 4399..4758 + 360 WP_000340272 type IV conjugative transfer system pilin TraA -
AYM09_RS24590 4773..5084 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
AYM09_RS24595 5106..5672 + 567 WP_000399792 type IV conjugative transfer system protein TraE traE
AYM09_RS24600 5659..6387 + 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
AYM09_RS24605 6387..7814 + 1428 WP_000146685 F-type conjugal transfer pilus assembly protein TraB traB
AYM09_RS24610 7804..8376 + 573 WP_000002780 conjugal transfer pilus-stabilizing protein TraP -
AYM09_RS24615 8373..8690 + 318 WP_001057292 conjugal transfer protein TrbD virb4
AYM09_RS24620 8687..8938 + 252 WP_001038341 conjugal transfer protein TrbG -
AYM09_RS24625 8935..9450 + 516 WP_000809906 type IV conjugative transfer system lipoprotein TraV traV
AYM09_RS27330 9585..9806 + 222 WP_001278689 conjugal transfer protein TraR -
AYM09_RS24630 9966..12593 + 2628 WP_001064268 type IV secretion system protein TraC virb4
AYM09_RS24635 12590..12976 + 387 WP_000214084 type-F conjugative transfer system protein TrbI -
AYM09_RS24640 12973..13605 + 633 WP_001203745 type-F conjugative transfer system protein TraW traW
AYM09_RS24645 13602..14594 + 993 WP_000830839 conjugal transfer pilus assembly protein TraU traU
AYM09_RS24650 14620..15081 + 462 WP_000277845 hypothetical protein -
AYM09_RS24655 15111..15563 + 453 WP_000069427 hypothetical protein -
AYM09_RS24660 15591..16229 + 639 WP_001104248 type-F conjugative transfer system pilin assembly protein TrbC trbC
AYM09_RS24665 16226..17086 + 861 Protein_24 conjugal transfer protein TraN -


Host bacterium


ID   3083 GenBank   NZ_LNUJ01000036
Plasmid name   SYAU4|unnamed1 Incompatibility group   -
Plasmid size   17150 bp Coordinate of oriT [Strand]   2432..2555 [+]
Host baterium   Escherichia coli strain SYAU4

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -