Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 102515 |
| Name | oriT_p4242AB  |
| Organism | Streptococcus dysgalactiae subsp. equisimilis strain UT_4242_AB |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_MATZ01000060 (489..524 [-], 36 nt) |
| oriT length | 36 nt |
| IRs (inverted repeats) | 15..22, 29..36 (AAAGTATA..TATACTTT) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 36 nt
>oriT_p4242AB
CACTTTTACGAAGTAAAGTATAGTGCGTTATACTTT
CACTTTTACGAAGTAAAGTATAGTGCGTTATACTTT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 1866 | GenBank | WP_171842255 |
| Name | mobV_BBG05_RS08670_p4242AB |
UniProt ID | _ |
| Length | 117 a.a. | PDB ID | |
| Note | Predicted by oriTfinder 2.0 | ||
Relaxase protein sequence
Download Length: 117 a.a. Molecular weight: 13853.51 Da Isoelectric Point: 6.7238
>WP_171842255.1 MobV family relaxase, partial [Streptococcus dysgalactiae]
MSYLVARMQKMKAGNLGGAYKHNERIFETHSNKDIDPSRSHLNYELTVRDRSVSYEKQIKDYVNENKISN
RAIRKDAVLCDEWIITSDKPFFEKLSEEETREFFETAKNYFAENYGL
MSYLVARMQKMKAGNLGGAYKHNERIFETHSNKDIDPSRSHLNYELTVRDRSVSYEKQIKDYVNENKISN
RAIRKDAVLCDEWIITSDKPFFEKLSEEETREFFETAKNYFAENYGL
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
Host bacterium
| ID | 2959 | GenBank | NZ_MATZ01000060 |
| Plasmid name | p4242AB | Incompatibility group | - |
| Plasmid size | 4858 bp | Coordinate of oriT [Strand] | 489..524 [-] |
| Host baterium | Streptococcus dysgalactiae subsp. equisimilis strain UT_4242_AB |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |